KEGG   Bacillus cellulosilyticus: Bcell_2464Help
Entry
Bcell_2464        CDS       T01389                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00900  Terpenoid backbone biosynthesis
bco01100  Metabolic pathways
bco01110  Biosynthesis of secondary metabolites
bco01130  Biosynthesis of antibiotics
Module
bco_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcell_2464
Enzymes [BR:bco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Bcell_2464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom PrpR_N NleF_casp_inhib Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ADU30721
UniProt: E6TSS9
Position
complement(2668330..2669478)
Genome map
AA seq 382 aa AA seqDB search
MKKIGLLGSTGSIGVQTLDVIRAHKSSFQLVTMSFGKNIEKGLAQINEFQPYIVSVETKE
IADQIAHQLPSHVKLVYGAEGIIEVATYHKMDLLVNAVMGSVGLKPTLAAIESRIDVAIA
NKETLVTAGHLVTQLAEKMGVELIPVDSEHSAIYQCLEGNIEKEVSRIILTASGGSFRDR
SIEELKTVTIEDALNHPNWNMGAKITIDSATMMNKGLEVIEAKWLFNIPYEKIDVILHKE
SIIHSMVEYIDGSVLAHLGSPDMRVPIQYALTKPERLDMYEGKKLNLWELGALHFQQVDY
ERFRCLHLAYEAGKIGGTAPTVLNAANEIAVSLFLQGKITFLQIEEIVEKALMMHRTSNS
PSLEEIVSVDKDTREKILSYIS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattggtttgttaggatcaacgggatcgattggagttcaaactttagatgtt
attcgagctcataaatcttcatttcaattagttacgatgagcttcggaaaaaatattgaa
aaagggcttgctcaaataaatgaatttcaaccttatattgttagtgtcgaaacgaaggaa
atagcggatcaaattgctcaccagttaccttcacatgtcaagctcgtatatggcgctgaa
ggcatcattgaagtagcaacttatcataaaatggatctgttagtgaatgcggtgatgggg
agcgttgggcttaaaccaacgttagcagctattgagtctcgtatagatgttgctattgca
aataaagagacgttagtcactgcaggtcatttggttacccaattggcggaaaaaatggga
gtagagcttatccctgttgatagtgaacattcagctatttaccaatgcttagaaggtaat
atagaaaaagaggtatcaagaattatattaactgcttcaggtggaagttttcgtgacagg
tctatagaagaattaaaaactgttacgattgaagatgcattaaatcaccctaattggaat
atgggggcaaaaataacaatcgattcagctacaatgatgaataaaggattagaagtgatt
gaagcgaaatggttatttaatattccatatgaaaaaattgatgtaatcttacataaagaa
agtatcattcactccatggttgaatatattgatggtagtgtactagcccatttaggtagt
ccagatatgagggtgccaattcaatatgctttaacaaagccagaaagacttgatatgtat
gaagggaaaaaattaaatttatgggaactaggtgcactacatttccaacaggtggattac
gaaagatttcgatgcttacacttggcttatgaagctggtaaaatcggtggaacagcacca
acggtactcaatgcagctaatgaaatagcagtatcactctttttacaaggtaaaatcacg
tttttacaaattgaagaaatagtagaaaaagcgttgatgatgcatcgcactagtaattct
ccctctcttgaggaaattgtctccgttgataaagatacgagagaaaaaatactatcctat
ataagctaa

DBGET integrated database retrieval system