KEGG   Bacillus cellulosilyticus: Bcell_2480Help
Entry
Bcell_2480        CDS       T01389                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bco  Bacillus cellulosilyticus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bcell_2480
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bcell_2480
Enzymes [BR:bco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bcell_2480
Two-component system [BR:bco02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Bcell_2480
Bacterial motility proteins [BR:bco02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bcell_2480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2681779..2682843)
Genome map
AA seq 354 aa AA seqDB search
MIKVLVVDDSAFMRKMISDLLEKDARIKVIGKARNGNEAVTQIKKLQPDVVTLDVEMPIL
NGLEALKRIMSESPVPVIMLSSITKEGTETTIKAMEYGAFDFVSKPSGSISLDIYKVQKE
LVEKVIYASKVPIAKLQKDVECRAPSIDEKQLQQINNNSKNKLTEKGIIAIGTSTGGPKA
LQTVLTNLPSDLPYPILIVQHMPKGFTKSLSERLDKLSKIKVKEAEDGEIIKKGVAYIAP
GGYHLKVRGIGTSVAVHLDQSELVKGHRPAVDALFYSLSALRNVDVMAIILTGMGSDGTK
GLVQLKGNTKTIAIAESKETAIVYGMPRTAVETNLVDEVVKLEDITQTILKHCT
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagttctagtagtggatgattcagcattcatgagaaagatgatcagcgattta
ctagaaaaagacgcacgaatcaaagtaattggtaaagctcgtaatggaaacgaagcagta
acacaaataaagaagttacagccagatgtagtaacactagatgttgaaatgccaatatta
aatggactcgaagcgttaaagcggattatgagtgaatctcctgtaccagtgattatgctg
tcaagcattacaaaggaaggaactgaaacaacaataaaagcaatggaatacggtgctttt
gattttgtttcaaagccttcgggctctatttcgttagatatttataaagtccaaaaagaa
ttagttgagaaggtgatttatgcgtcaaaagtcccgatcgctaaattacaaaaggatgtt
gaatgtcgtgcaccttcgatagatgaaaaacagttgcaacaaattaataataatagcaaa
aacaagttaacagaaaagggtattatcgcaattggaacttcaacaggaggtccgaaagcg
cttcaaacagttttaactaatttaccgtctgatcttccttacccaatattaattgtacag
cacatgccaaaaggctttacgaaatcattaagtgagcgccttgataaattatcaaaaatt
aaggtgaaagaagcagaggatggagaaattataaaaaaaggtgttgcctatatcgctcct
ggaggataccatttaaaagtaagaggtattgggacttctgtagcagttcatttggatcaa
tcggaattagtgaaaggacatcgacctgcagttgatgcattattttattcattatctgca
ttaagaaatgtcgatgttatggcaataattttaacaggtatgggatctgatggtacgaaa
ggtctagtgcagctgaaggggaatacaaaaacaattgcgattgcagagtctaaagaaaca
gcgattgtctatggaatgccaagaaccgcggttgaaacaaatttggttgacgaagtggtt
aaattagaagatatcacacaaacaatattgaagcattgtacatag

DBGET integrated database retrieval system