KEGG   Bacillus cellulosilyticus: Bcell_2515Help
Entry
Bcell_2515        CDS       T01389                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bco  Bacillus cellulosilyticus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcell_2515
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcell_2515
   00640 Propanoate metabolism
    Bcell_2515
   00660 C5-Branched dibasic acid metabolism
    Bcell_2515
Enzymes [BR:bco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bcell_2515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2714108..2715271)
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQGKEILRSYGVAVPNGKVAFSVDEAVEAAKSLGTEVNVVKAQIHAGGRGKAGGV
KVAKSLDEVRTYADEILGKTLVTHQTGPEGKEVKRLLIEEGCDIKSEYYVGLVVDRATDR
IVMMASEEGGTEIEEVAEETPEKIFKEVIDPVVGLMPYQARRLAFNINIPKDLVREAVKF
MLGLYQVFADKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRQKAILEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMATMDIIKHYNGDPANFLDVGGGATKEKVTE
AFKIILSDENVKGIYVNIFGGIMKCDVIAEGVVAATKEVGLEIPLVVRLEGTNVDLGKKI
LEESGLDITAADSMADGAEKIVSLVKG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtatcaaggtaaggaaatactaagaagctacggggttgctgttcca
aatggtaaagtagctttttctgttgatgaagcagttgaagcagccaagtcgttaggaaca
gaagtaaacgttgtcaaagctcaaatccatgcaggtggacgcgggaaagcgggcggtgta
aaagtagctaaaagtttagacgaggtacgtacatacgctgatgaaattcttgggaaaacg
ttagttactcatcaaactggtcctgagggtaaagaggtaaaaagattgttaatagaagag
ggctgcgatattaaaagtgagtattacgtaggccttgtagttgacagagcaactgatcgc
attgtgatgatggcttctgaggaaggcggaacagaaatcgaggaagttgcagaagagaca
cctgagaagatctttaaagaagtaatcgatcctgtagttggtctcatgccataccaagca
agaagacttgcatttaacattaatattccgaaggatttagttcgtgaggcagtaaaattt
atgttagggctttaccaagtatttgcagacaaagattgttccattgctgaaatcaatcca
ctagtaacgactggtgatggtaaagtaatggcgctagatgcaaaacttaactttgattca
aatgcgctctatcgtcaaaaagcaattttagaatatcgtgatctcgatgaagaggatcca
aaggaaattgaagcttctaaatatgacttaagctacatatcgctagatggaaacattggc
tgtatggtaaacggtgcaggtctagcaatggcaacaatggacattattaaacattataat
ggtgaccctgcaaacttcttggacgttggcggtggtgcaacgaaagaaaaggtaactgaa
gcattcaaaattatcctatctgacgaaaacgtaaaaggtatttacgtaaatattttcggt
ggaattatgaaatgtgatgtgattgcagaaggtgttgttgccgcaacaaaagaagtaggc
ttagaaattccacttgttgttcgattagaaggaactaatgttgatctaggaaagaaaatc
ttagaagaatctggactagatattacagccgcggattcaatggctgatggtgcagaaaaa
atcgtttctctagttaaaggatag

DBGET integrated database retrieval system