KEGG   Bacillus cellulosilyticus: Bcell_2666Help
Entry
Bcell_2666        CDS       T01389                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00010  Glycolysis / Gluconeogenesis
bco00020  Citrate cycle (TCA cycle)
bco00620  Pyruvate metabolism
bco01100  Metabolic pathways
bco01110  Biosynthesis of secondary metabolites
bco01120  Microbial metabolism in diverse environments
bco01130  Biosynthesis of antibiotics
bco01200  Carbon metabolism
Module
bco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcell_2666
   00020 Citrate cycle (TCA cycle)
    Bcell_2666
   00620 Pyruvate metabolism
    Bcell_2666
Enzymes [BR:bco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bcell_2666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H ATP-synt_ab_Xtn QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ADU30921
UniProt: E6TUN1
Position
complement(2873356..2874654)
Genome map
AA seq 432 aa AA seqDB search
MAYEFKMPDIGEGIHEGEIVKWEVKEGQEVKEDDVLCEVQNDKAVVEIPSPVDGKVQKIH
VEEGVVTTVGSVIITFETDAVQPPSAHGDHEEEAPKEEAKAETTDQAKAEEASEPAAHVE
VDENRRVIAMPSVRKYAREKGVTIQQVNGSGKNGRIVKEDIDSFLSGGQPTAEAAQEAPS
APEATAEKKPVAPYKPANAELETREKMSGIRKAISKAMVNSKHTAPHVTLMDEIEVTDLV
AHRKKFKEVGAEKGIKLTYLPYVVKALTSALREYPMLNTSLDDSTDEIVHKHYYNIGIAA
DTEKGLLVPVVKDTDRKSIFAISDEINQLASKAREGTLAPDEMKGASCTITNIGSAGGQW
FTPVINHPEVAILGLGRIAEKAVVRDGEVVVAPVLALSLSFDHRIIDGATAQHALNHIKR
LLNDPQLIVMEG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtacgaatttaaaatgcctgatattggtgaaggaatccatgagggtgaaatagtg
aagtgggaagtaaaagaaggacaagaagtgaaggaagacgatgtactttgtgaagtacaa
aatgataaagctgtagtagaaattccatctcctgttgatggtaaagtacaaaaaattcat
gttgaggaaggtgtcgtaacaactgttggatcagtaattattactttcgaaacagatgca
gttcaaccgccttcagctcatggagatcatgaggaagaagctcctaaagaagaagcgaaa
gctgaaactacagatcaagcgaaggcagaagaggcttccgaacctgcagcacacgttgaa
gtagatgaaaatcgtcgtgtaattgcgatgccttctgttcgtaaatatgcacgtgagaaa
ggcgttactattcaacaagttaatggtagtggcaaaaatgggcgtatcgttaaagaggat
atcgattccttcttatcgggtggtcaaccaactgctgaagcagcacaggaagcaccatca
gcaccagaagctactgcagagaaaaagccagttgcgccttataagccagctaatgcagaa
cttgaaactcgtgaaaaaatgtctggtattcgtaaagcgatctctaaagcgatggttaat
tccaagcatacagctccacacgttacattaatggatgaaattgaagtaacagatttagta
gcacaccgtaagaagtttaaagaagtgggtgcagaaaaaggaattaagctaacttattta
ccatatgtagtaaaagcattaacatcggcactacgtgaatacccaatgctaaatacatct
ttagacgattctacagatgaaattgttcataaacattactacaacatcggtatcgcagca
gacacagaaaaaggtctccttgtgccagttgtaaaagatacagatagaaagtctattttt
gcaatctctgatgaaattaatcagcttgcatcaaaagcgcgtgaaggtacgttagctcca
gatgaaatgaaaggtgcttcttgtacaatcacaaatatcgggtcagctggagggcaatgg
ttcacaccggtaattaaccatccagaagttgctattttaggtttaggacgtattgctgaa
aaagcagttgtacgtgatggggaagtagttgttgcaccagtattagcattatcgttaagc
ttcgaccaccgtatcattgatggggcaacagctcagcatgcgttaaatcacattaagcga
ttattgaacgacccacaattaattgtaatggagggctaa

DBGET integrated database retrieval system