KEGG   Bacillus cellulosilyticus: Bcell_3127Help
Entry
Bcell_3127        CDS       T01389                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00860  Porphyrin and chlorophyll metabolism
bco01100  Metabolic pathways
bco01110  Biosynthesis of secondary metabolites
bco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bcell_3127
Enzymes [BR:bco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Bcell_3127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 ANF_receptor RRM_7
Motif
Other DBs
NCBI-ProteinID: ADU31370
UniProt: E6TZR4
Position
complement(3324424..3325197)
Genome map
AA seq 257 aa AA seqDB search
MTSPLQGYTLLNTRAIHQAAPLTKYLEKHGGNVVEIPLISMKKTSDPKIKEAIKMIHTYD
YIVFTSTNSISFFLEILKEQGLSKREICNMKFAVVGKSTLRSLNKEGFDADIIPPIFDAE
HLASALKTELSAGEKVLYPKSDLARDVLTRELHKVGIQIDDPSVYETVFRIDDKAKLNEL
IKKNLIHIIIFTSPSTVHSFFSQVDKEVVMNNVDKLHFAVIGSVTSRALKDEGIEEMIIP
KEFTTEALVHAIMKHIK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaccacttcaaggctatactttattaaacacgagggcgattcaccaagccgcg
cctttaacgaaatacttggaaaagcatggggggaatgtcgtagaaattccccttatttcc
atgaaaaaaacgtctgacccaaaaataaaagaagcgataaaaatgatacatacgtatgat
tacattgtttttacgagcacgaatagtatctccttttttctagaaatccttaaagaacaa
ggtctgagtaagcgtgaaatatgtaacatgaaatttgcagttgtagggaaaagtacgtta
agaagcttaaataaagaaggcttcgacgctgatattataccgccaatttttgatgcagag
catttagcatctgcattaaaaacagaactgtcagccggagagaaagtactctatccgaaa
agcgatcttgctagagatgtcttaactagagaattacataaggttggtattcagatcgat
gatccgtctgtttatgaaacagtgtttcgtatcgatgataaggcaaaattaaatgaactt
ataaaaaagaacttaatacatattattatttttactagtccatcaacagtgcattctttt
ttctcgcaagtcgataaagaagtggtgatgaacaatgtggacaagctccattttgcggta
atagggtcagtcactagtcgtgcattaaaggatgaaggaattgaagagatgatcatccct
aaggaatttacgacagaagctttagtccatgcaatcatgaagcatattaaataa

DBGET integrated database retrieval system