KEGG   Bacillus cellulosilyticus: Bcell_3321Help
Entry
Bcell_3321        CDS       T01389                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bco  Bacillus cellulosilyticus
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bcell_3321
Enzymes [BR:bco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bcell_3321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3538482..3539267)
Genome map
AA seq 261 aa AA seqDB search
MWKWEVEKPKGVFVIVHGAGEYHVRYKWVREQLNKLQYNVIQGDLPGQGTTTGPRGHINS
FHDYIQVVKKWLNEATKYDVPIILLGHSMGSLISIHTLMSLQKAALPHAVVLSSPCLGLV
NEPDFNKKVAAHILNVVYPSFRFPSGLVPGSGTRDEWMRSRDKHDDKLIKKVSVRWYREL
DKAMTNAIENVNEFPDVPLLVTQAGGDLITNKHKAKEWFDRLPISNKYYKEWDHLYHEVL
NEPERHKVLAHLIGFVTLQRS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaatgggaagttgaaaagcctaaaggtgtttttgttatcgtgcatggagctggt
gaatatcatgtacgctataaatgggtgagagaacaattgaacaagctccaatacaatgtc
atacaaggagatttgcctggccaagggacgacaactggaccaagaggccatattaactcc
tttcatgactacatccaagtcgtaaaaaaatggttaaatgaagcaacaaagtatgatgtg
ccaatcatattacttggacatagtatgggatcactgatttctattcacacgttgatgtcg
ttacaaaaagctgctttgccacatgctgtagtattatcatccccgtgcttaggattagtg
aatgaacctgactttaataaaaaagttgctgctcatattttaaatgttgtttatccaagc
tttcggtttccatctggattagtaccaggatcaggcactagagatgagtggatgcgaagt
cgtgataagcatgacgataagctaatcaaaaaggtgagtgttcgctggtaccgagaatta
gacaaggcgatgacaaatgcgattgagaatgtaaatgaatttccggatgtacctctttta
gtaacacaagctggaggagacttaattacgaataaacataaggcgaaggaatggttcgac
cgtttacctatatcaaataaatactataaagaatgggatcatttatatcacgaagtatta
aacgagcctgagcgccataaagtattagctcacttgatagggtttgtaacattacagcga
tcatga

DBGET integrated database retrieval system