KEGG   Bacillus cellulosilyticus: Bcell_3321Help
Entry
Bcell_3321        CDS       T01389                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bcell_3321
Enzymes [BR:bco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bcell_3321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 DUF1057 LIDHydrolase PGAP1 Cellulase LCAT Abhydrolase_2 Thioesterase Abhydrolase_3 DUF900 DUF1350 Ser_hydrolase Abhydrolase_8 DUF676
Motif
Other DBs
NCBI-ProteinID: ADU31563
UniProt: E6U1R6
Position
complement(3538482..3539267)
Genome map
AA seq 261 aa AA seqDB search
MWKWEVEKPKGVFVIVHGAGEYHVRYKWVREQLNKLQYNVIQGDLPGQGTTTGPRGHINS
FHDYIQVVKKWLNEATKYDVPIILLGHSMGSLISIHTLMSLQKAALPHAVVLSSPCLGLV
NEPDFNKKVAAHILNVVYPSFRFPSGLVPGSGTRDEWMRSRDKHDDKLIKKVSVRWYREL
DKAMTNAIENVNEFPDVPLLVTQAGGDLITNKHKAKEWFDRLPISNKYYKEWDHLYHEVL
NEPERHKVLAHLIGFVTLQRS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaatgggaagttgaaaagcctaaaggtgtttttgttatcgtgcatggagctggt
gaatatcatgtacgctataaatgggtgagagaacaattgaacaagctccaatacaatgtc
atacaaggagatttgcctggccaagggacgacaactggaccaagaggccatattaactcc
tttcatgactacatccaagtcgtaaaaaaatggttaaatgaagcaacaaagtatgatgtg
ccaatcatattacttggacatagtatgggatcactgatttctattcacacgttgatgtcg
ttacaaaaagctgctttgccacatgctgtagtattatcatccccgtgcttaggattagtg
aatgaacctgactttaataaaaaagttgctgctcatattttaaatgttgtttatccaagc
tttcggtttccatctggattagtaccaggatcaggcactagagatgagtggatgcgaagt
cgtgataagcatgacgataagctaatcaaaaaggtgagtgttcgctggtaccgagaatta
gacaaggcgatgacaaatgcgattgagaatgtaaatgaatttccggatgtacctctttta
gtaacacaagctggaggagacttaattacgaataaacataaggcgaaggaatggttcgac
cgtttacctatatcaaataaatactataaagaatgggatcatttatatcacgaagtatta
aacgagcctgagcgccataaagtattagctcacttgatagggtttgtaacattacagcga
tcatga

DBGET integrated database retrieval system