KEGG   Bacillus cellulosilyticus: Bcell_3371Help
Entry
Bcell_3371        CDS       T01389                                 

Definition
LPXTG-motif cell wall anchor domain-containing protein (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bco  Bacillus cellulosilyticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bco00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3598984..3601890)
Genome map
AA seq 968 aa AA seqDB search
MKKKLRKFLAVMMTFLLVATLFAPMVSAEENGNGEEEAPLVNPLPISQDPHVSNYEKYPA
LLDNGVPKASEGGALSLKEVNGQMTLVDKNNNPIQLRGMSTHGLQWFGEIVNENAFAALA
DDWGSNMIRLALYVGENGYATRPELINKVYDGIDLAIENDMYVIVDWHVHAPGDPRADVY
SGAEEFFLTIAEKYPNNPNILYELANEPSSNNNGGPGITNDEAGWEAVKEYADPIVEALR
NSGNADDNIIIVGSPNWSQRPDLAADNPIDDHHTMYTVHFYTGTHNGTNDSYPEETPSDK
RSNVMANAKYALDNGVAVFATEWGVSEANGDNGPYLNEADIWLNFLNKNNISWANWSLTN
KNETSGSFTPFQLNVSEATPLDPGDGQVWTKEQLSLSGEYVRSRIIGEEYEPIDRTPRET
FTEVIWDFNDGTTQGFGVNAGSTLEGFTVTNENNALQIAGISEANSVWDVRISADNWDET
VDIAGAQELSMEIIVDEPTMVEIGAIPQSASAGWANPVEVAVSPEDFDLQEDGNYMAVLT
LTAEDAPNLSNIANSSEDSLLNNIILLINTEDADAISLDNISVSGDRESIPEPVVHDEKG
TATLPSTFEDGTRQGWDWHSESGVKTSLTIEEANGSNALSWEYAYPEVKPSDGWATAPRL
DFWKDNLVRGDNEFVAFDFYIDPVEERATEGEISINLTFQPPSMGFWAQAPSTFDIDLEA
LDEATLTEDGLYHFEVEIDITNITNLQDDTELRNMMLIFADGESDFAGRVYVDNVRFDMS
LEKKVEVLSRTIAELLEQIETIEADNAERIAELEDQIAELEEQLNELVDSSVVEELQRII
EDLLAQIAALEQQVQELKDAANGVTPQPGNGDGSSDDVDNGTTDGGDNGSTDGENNGSEE
GESGSTEDEDSDSSDGAEETGSSSKEGKDGEKLPNTATNMFNFLMVGLMLLAIGIVTFVI
KRKNVAIK
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagaaattaagaaagtttttagcagtaatgatgacgtttttattagtagcaacc
ttatttgcaccgatggtaagtgcggaagaaaatgggaatggagaagaggaagcgccatta
gttaatccacttccaattagtcaagatccacacgtatcaaattatgagaaatatcctgct
ttattagataatggtgttccaaaagcttctgaaggtggagcattatcacttaaagaagta
aatggacagatgacattagtagacaaaaacaacaatcctattcaattacgtggaatgagt
acacacggtttacaatggtttggtgagattgtgaatgagaacgctttcgctgcgttagca
gacgattggggttcaaatatgattcgtctagcactctatgttggtgaaaatggttatgca
acgagaccagaattaattaacaaagtatatgacggaattgatttagctattgaaaacgac
atgtacgtaattgttgactggcatgtgcatgctcctggtgatccacgagctgatgtatac
tctggtgcagaagaatttttcttaacaattgcagaaaaatatcctaacaatccaaatata
ctttatgagcttgcaaatgagccaagttcaaataataatggtggccctggaattacgaat
gatgaagctggttgggaagctgtaaaagaatatgctgatccaattgttgaagcacttcga
aatagcggtaatgctgatgacaatatcatcattgtagggagtcctaactggagccaacgt
ccagacttagcagcagataaccctattgatgatcaccatacaatgtatacagtgcatttc
tatactggtacacataatggtactaatgacagctatccagaagaaacacctagcgataag
cgttcaaatgtaatggcaaatgcgaaatatgcattagataacggtgtagcagtttttgca
actgagtggggagttagtgaagctaatggagataacggtccttatttaaatgaggctgac
atctggcttaacttcttaaataaaaataatattagctgggctaactggtcattaacaaat
aaaaatgaaacatctggatcatttacaccatttcagttaaatgtttcagaagcaactcct
cttgatccaggtgatggacaagtatggacgaaagagcaattaagtctctcaggtgaatat
gtacgttcacgtatcattggtgaagaatatgagccaattgaccgtacaccaagagaaact
ttcactgaagttatttgggacttcaatgatggtacgactcaaggatttggggttaatgct
ggtagcacattagaaggcttcactgttacaaatgagaataacgcactacaaatagctgga
attagtgaagctaatagtgtttgggatgtgcgtatatcagctgataattgggatgaaact
gttgatattgctggtgcacaagaattatcgatggaaattatagttgacgaacctactatg
gttgaaattggtgcaattccacaaagtgcttctgctggatgggcaaatccagttgaagta
gcagtatctccagaagattttgatttacaagaagacgggaattacatggcagtgcttact
ttaactgctgaagatgctccaaatttaagtaatattgctaatagttctgaagatagtttg
ctgaataacattattttactgataaatactgaagacgcagatgctatctctttagataac
atttcagtgtctggggatcgtgaatcaattccagagccagttgttcatgatgaaaaagga
actgcaacacttccttcaacttttgaagacggtactcgccaaggctgggattggcatagt
gaatctggagttaaaacatctttaacaattgaagaagctaatggttcaaacgcgctttct
tgggaatatgcttacccagaagtaaaaccaagtgatggatgggctacagctccacgctta
gatttctggaaagataatttagtacgcggagataatgagttcgttgcatttgatttttac
attgatccagttgaagaacgagcaactgaaggtgagatttcaattaatttaacattccaa
ccaccttcaatgggattctgggcacaagctccgagtacatttgacattgatttagaagca
ttagatgaagcaacattaacagaagatggattatatcactttgaagtagaaatagacatt
acgaatattactaatttacaagacgatacagagttacgtaatatgatgcttatttttgct
gatggtgaaagtgattttgctggtagagtttatgtagataacgtaagatttgatatgtct
ctagagaaaaaagtagaagttctatcaagaacaattgctgaattattagagcaaattgaa
actattgaagctgataatgctgaaagaatagcagaattagaagatcagattgctgaacta
gaagaacaacttaacgaattagttgattcatcagtagtagaagaacttcaacgtattatt
gaggatttactagctcaaatagcggctcttgagcaacaagtacaggaattaaaagatgct
gcaaacggagtaacacctcaaccaggtaatggtgatggttcttctgacgatgtagacaat
ggtactactgatggaggagacaatggttctactgacggagaaaataatggttctgaagaa
ggggaatctggatctacagaagatgaggacagtgactcttcagatggtgcagaagagact
ggatcttctagtaaagaaggtaaagatggtgagaaattaccaaacactgctacaaacatg
tttaacttcttaatggtaggtttaatgttacttgctattgggattgtaacttttgttatt
aagagaaaaaatgtagcaattaagtaa

DBGET integrated database retrieval system