KEGG   Bacillus cellulosilyticus: Bcell_3403Help
Entry
Bcell_3403        CDS       T01389                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K21567  
ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
bco  Bacillus cellulosilyticus
Brite
Enzymes [BR:bco01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     Bcell_3403
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     Bcell_3403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3641745..3642740
Genome map
AA seq 331 aa AA seqDB search
MTTEREVYDVTIIGGGPVGLFTAFYGGMRQMKVKIIESMPQLGGQLSALYPEKYIYDVAG
FPKVRAQELVDELWKQANQFEPTVVLEQSVDKVEKGDDNIFTLTTTKEKHYTKTVIITAG
VGAFQPRRLEVEGAEEYEGKNLHYFVNDLNKFAGDRVLLSGGGDSAVDWTLMLEDIAEEI
TIVHRRNKFRAHEHSVEQLTGSQKIGIKTPYVITKLHGNGDKITSVDIQEKNGDTTETID
IDTLIVNFGFISNLGPIKEWGLEIEKNSIVVNSKMETNIEGVYAAGDIATYDGKVKLIAT
GFGEAPIAVSSAKSYVDPNAKAHPGHSTSLF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacagaaagagaagtttatgacgtaacgattatcgggggcggaccagttggtctc
tttactgcattttatggtgggatgagacagatgaaggtgaaaattatagaatctatgcct
caacttggtgggcaattatctgctttataccctgaaaagtacatttatgacgtagcggga
tttccaaaagtccgtgcacaagagttagttgatgaattgtggaaacaagcaaatcaattt
gaaccaactgttgttttagaacaatcagttgataaagttgaaaaaggtgacgataacatc
tttacattaacaacaacgaaagaaaagcattacacaaaaacagttattatcactgcgggt
gttggtgctttccaaccaagacgtttagaggttgaaggtgctgaggagtacgaaggtaaa
aacttacactattttgttaatgacttaaacaaattcgctggagaccgggttcttttatct
ggtggtggtgattctgcagttgattggacgcttatgcttgaagatattgcagaagaaatt
acaatcgttcatagaagaaataaattccgcgcacatgagcacagtgtggagcaattaaca
ggttctcaaaaaattggtattaagacaccttatgtgattactaaattacacggcaatgga
gataagattacttctgttgatattcaagaaaaaaatggagatacaactgaaacaattgat
atcgacacgctaattgtaaactttggtttcatttctaaccttggtccaattaaagagtgg
ggcttggaaatcgagaaaaattccattgttgtcaattctaaaatggaaacaaacatcgaa
ggcgtttatgcagctggggatattgctacatacgacggaaaagttaaattaattgctact
ggatttggagaagcaccaattgcagtcagcagtgctaaatcttacgtagaccctaatgca
aaagctcatcctggacatagtactagtttgttttaa

DBGET integrated database retrieval system