KEGG   Bacillus cellulosilyticus: Bcell_3403Help
Entry
Bcell_3403        CDS       T01389                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K00384  
thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
bco  Bacillus cellulosilyticus
Pathway
Pyrimidine metabolism
Selenocompound metabolism
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bco00240]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:bco00450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3641745..3642740
Genome map
AA seq 331 aa AA seqDB search
MTTEREVYDVTIIGGGPVGLFTAFYGGMRQMKVKIIESMPQLGGQLSALYPEKYIYDVAG
FPKVRAQELVDELWKQANQFEPTVVLEQSVDKVEKGDDNIFTLTTTKEKHYTKTVIITAG
VGAFQPRRLEVEGAEEYEGKNLHYFVNDLNKFAGDRVLLSGGGDSAVDWTLMLEDIAEEI
TIVHRRNKFRAHEHSVEQLTGSQKIGIKTPYVITKLHGNGDKITSVDIQEKNGDTTETID
IDTLIVNFGFISNLGPIKEWGLEIEKNSIVVNSKMETNIEGVYAAGDIATYDGKVKLIAT
GFGEAPIAVSSAKSYVDPNAKAHPGHSTSLF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacagaaagagaagtttatgacgtaacgattatcgggggcggaccagttggtctc
tttactgcattttatggtgggatgagacagatgaaggtgaaaattatagaatctatgcct
caacttggtgggcaattatctgctttataccctgaaaagtacatttatgacgtagcggga
tttccaaaagtccgtgcacaagagttagttgatgaattgtggaaacaagcaaatcaattt
gaaccaactgttgttttagaacaatcagttgataaagttgaaaaaggtgacgataacatc
tttacattaacaacaacgaaagaaaagcattacacaaaaacagttattatcactgcgggt
gttggtgctttccaaccaagacgtttagaggttgaaggtgctgaggagtacgaaggtaaa
aacttacactattttgttaatgacttaaacaaattcgctggagaccgggttcttttatct
ggtggtggtgattctgcagttgattggacgcttatgcttgaagatattgcagaagaaatt
acaatcgttcatagaagaaataaattccgcgcacatgagcacagtgtggagcaattaaca
ggttctcaaaaaattggtattaagacaccttatgtgattactaaattacacggcaatgga
gataagattacttctgttgatattcaagaaaaaaatggagatacaactgaaacaattgat
atcgacacgctaattgtaaactttggtttcatttctaaccttggtccaattaaagagtgg
ggcttggaaatcgagaaaaattccattgttgtcaattctaaaatggaaacaaacatcgaa
ggcgtttatgcagctggggatattgctacatacgacggaaaagttaaattaattgctact
ggatttggagaagcaccaattgcagtcagcagtgctaaatcttacgtagaccctaatgca
aaagctcatcctggacatagtactagtttgttttaa

DBGET integrated database retrieval system