KEGG   Bacillus cellulosilyticus: Bcell_3513Help
Entry
Bcell_3513        CDS       T01389                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bco  Bacillus cellulosilyticus
Brite
Enzymes [BR:bco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Bcell_3513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3759887..3760642)
Genome map
AA seq 251 aa AA seqDB search
MMKITQPKPFTFEAGKRAVLLLHGFTGNSADVRMLGRFLEKKGYTSHAPQYKGHAVPPEE
LLHYSPADWWEDVQKGYQHLKDLGYEEIAVGGLSLGGVFSLKVGYTLPVKGIIPMCAPIS
IQKSLDRLHTGVLEYAKKYKEHEKKEKAQIEEEMDNFDGPELQQLLQSMRKNNEDVRSNV
DMIYAPTLVVQARNDHMIDTNSANIIYEEIQSDEKEIKWYENSGHVITLDKEKDQLHEDV
YAFLERLDWSV
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaattacacagccaaagccgtttacatttgaagcagggaagagagcagtacta
ttgttacatggatttacagggaattcagcagatgtaagaatgctaggaagatttttggag
aaaaaaggatatacgtctcatgcacctcaatataaaggacacgcggtgccaccagaagaa
ctactgcattattctccagcagactggtgggaagatgttcaaaaaggctatcagcattta
aaagaccttggctacgaggagattgctgttggtggactttctctcggtggtgtattttct
cttaaagtagggtacacactaccagtaaagggcataataccaatgtgtgcaccaatttcg
atccaaaagagccttgatcgattacatacaggtgtgttggaatatgcaaaaaagtataag
gagcatgagaagaaggaaaaagcacaaatcgaagaggaaatggataacttcgacgggcca
gaattacaacagctactacaatctatgcggaaaaataatgaggatgtccgtagcaatgtt
gatatgatttacgcaccgacccttgttgttcaagctcgaaatgatcacatgattgataca
aatagcgcaaatatcatctatgaggaaattcaatctgatgaaaaagagataaaatggtat
gaaaactcagggcatgttattacgttagataaggagaaggatcagttacacgaagatgtg
tacgcttttcttgaaagactagattggagtgtataa

DBGET integrated database retrieval system