KEGG   Bacillus cellulosilyticus: Bcell_3518Help
Entry
Bcell_3518        CDS       T01389                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bco  Bacillus cellulosilyticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcell_3518
   01230 Biosynthesis of amino acids
    Bcell_3518
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcell_3518
   00051 Fructose and mannose metabolism
    Bcell_3518
   00562 Inositol phosphate metabolism
    Bcell_3518
Enzymes [BR:bco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bcell_3518
Exosome [BR:bco04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bcell_3518
  Exosomal proteins of bladder cancer cells
   Bcell_3518
  Exosomal proteins of melanoma cells
   Bcell_3518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3766536..3767294)
Genome map
AA seq 252 aa AA seqDB search
MRKPIIAGNWKMNKTKGEALSFIEEVKSAVPSKDVVESVICAPDLFLDALVSATEGSDVE
VGAQNMHFEESGAFTGETSPVALKDLGVSYVVIGHSERREMFGETDESVNQKVHAAFNHG
LTPIVCVGETLEEREGNKTSEVVTTQVTAALKGLSEEQVKATVIAYEPIWAIGTGKTASS
EDANETCGVIRQVVKSIVSDSAAEAVRIQYGGSVKPANIGELLAQSDIDGALVGGASLEA
KSYLQLVEAGNE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaatcattgcaggaaactggaaaatgaacaaaacgaaaggggaagcacta
agcttcatcgaagaagtaaagtccgctgtcccatcaaaagatgttgtagaatccgttatt
tgtgcaccagacttattcctagatgctttagtaagtgcaacagaaggctctgacgtagaa
gtcggtgctcaaaacatgcacttcgaggaaagtggagcatttactggagaaacaagtcca
gtagcacttaaagatttaggtgtaagctatgtcgttattggacattctgagcgacgtgaa
atgtttggtgaaacggatgagagtgtgaaccaaaaagtacatgctgcatttaaccacggg
ttaacaccgatcgtttgtgttggtgaaacgttagaagagcgtgaaggaaataaaacatct
gaagttgttactacacaagtaacagcagcacttaaaggtctatcagaagaacaagtaaag
gcaactgtaattgcttacgagccaatttgggcaatcggaactggtaaaacagcttcttct
gaagatgcaaatgaaacttgtggcgttatccgccaagttgtaaaaagcatcgtttctgac
tctgctgcggaagcagtacgaattcagtatggtggaagtgtaaagcctgctaacattggt
gaactacttgcacaatctgatattgacggtgcgctagttggtggcgcaagcttagaggca
aaatcttatcttcagttagtggaggcaggaaatgagtaa

DBGET integrated database retrieval system