KEGG   Bacillus cellulosilyticus: Bcell_3538Help
Entry
Bcell_3538        CDS       T01389                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00340  Histidine metabolism
bco01100  Metabolic pathways
bco01110  Biosynthesis of secondary metabolites
bco01230  Biosynthesis of amino acids
Module
bco_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Bcell_3538
Enzymes [BR:bco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Bcell_3538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh DUF3029
Motif
Other DBs
NCBI-ProteinID: ADU31779
UniProt: E6TRE9
Position
complement(3784690..3785961)
Genome map
AA seq 423 aa AA seqDB search
MKIIPLTEDVSLKRSIDQGTEEQRKAVSEIVTTVRQEGDKALQQFTEKFDGVRVSDLLVT
NEEITKAYETVSEETIEIIREARDNIRDFHARQVQQSWMTTAANGTILGQKVTPLDAVGV
YVPGGRAAYPSTILMNVVPAQVAGVERVVMTSPPQKDGTLNDVVLVTANELGVKEIYKVG
GAQAIAALAYGTETITAVDKIVGPGNIFVALAKQQVFGTVAIDMIAGPSEIVVLADASAN
PEYVAADLLSQAEHDPMASAVLVTTDAHVAEAVAEEVKKQLETLPKREIAQASMDDYGAI
YIATSLSEAVDAVNELAPEHLEVVVEDPWAVLPLIRHAGAIFLGEYSSEPVGDYFAGPNH
VLPTNGTARFSSPLTVEDFTKKSSIISYSKAAVKQHGEKISAFARLEGLEAHARAIDYRL
KEK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcatccctttaacagaagatgtatcattaaaacgctccattgaccaaggaaca
gaggagcagcgcaaagctgtcagtgaaatcgtcacaacagtaagacaggaaggtgacaaa
gcgctccaacaatttacggaaaaattcgatggggtgcgtgtgtcagatttactcgttacg
aatgaagagattacaaaagcttatgaaacagtaagcgaggaaacgatcgaaattatccgc
gaggcgcgtgataacatccgagattttcacgcaagacaggtgcagcaatcttggatgaca
acagcagcaaacggcacaatactagggcagaaggtgacaccgcttgatgctgttggcgtt
tatgtacctggaggacgtgcggcgtatccatcgacaatcttaatgaatgttgttccagcg
caagtagctggtgttgagcgggttgtcatgacatcgcctccgcaaaaggatggcacgtta
aacgatgttgtcctcgttactgcaaatgagctaggtgtaaaggaaatttataaagtaggt
ggtgctcaagcgatagcggcgcttgcttacggaactgaaacaatcacagctgtcgataaa
attgtcggtccaggaaacatctttgttgcgcttgcgaaacaacaggtgttcggaacggtg
gcgatcgatatgattgctggtccaagtgagatagttgtacttgcagatgcaagtgcaaat
ccagaatacgtcgcagcagatttattatcacaagcagagcacgatccgatggcatcagcg
gtattagtcacaacagacgcgcatgtagcagaagcagtagcagaagaagtgaaaaagcag
cttgaaacacttccaaagcgagaaattgcacaagcatcgatggatgactacggagcaatt
tatatcgccacttcactttcagaggcagtcgatgcagttaatgaattagcacctgagcat
ctagaggttgttgtagaggatccttgggctgtattaccactcattagacacgcaggagcg
atcttcttaggggagtatagctcggagccagttggtgattattttgctgggccaaatcac
gttttacctacaaatggtacagcgaggttttcaagcccgctaactgttgaagacttcacg
aaaaagtcgagtattatttcttatagtaaagcagcagtaaagcaacacggtgaaaagatt
tctgctttcgctagattagaaggattagaagcgcatgcaagagcaattgactaccgacta
aaagaaaaataa

DBGET integrated database retrieval system