KEGG   Bacillus cellulosilyticus: Bcell_3593Help
Entry
Bcell_3593        CDS       T01389                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bco  Bacillus cellulosilyticus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcell_3593
Enzymes [BR:bco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Bcell_3593
Peptidases [BR:bco01002]
 Cysteine Peptidases
  Family C44
   Bcell_3593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3851908..3853836
Genome map
AA seq 642 aa AA seqDB search
MCGFVGMVSNNSESLNQLPLEEMMNVIAHRGPDDAGTFGDQHVRLGFRRLSIVDIEKGHQ
PMCYAEDRYTIIFNGEIYNAPELREQLIDAGLSFQTNSDTEVILAAYHYYGDDCVSKLRG
MFSFIIWDKKESRLFGARDPFGIKPLFYRELRDGTIIFASEKKSLFFLNEPTYIEGEAAF
HYLTFQYAPEPHTVTANIMKVEPGHSFSWKPYESLRMYTYFTPTFIEKEKNRKWLAPFKR
NALKIEKDEMTSSIKNTLIDSVKCHMRSDVPVGAFLSGGIDSSAIVAIAKQFHPNLNTFT
AEFDRDGFSEGDVAEETAKALDVNHTRVKISVEDVMKELPKILWQMDEPVADPAAIPLYF
VAQEASRHVTVVLSGEGADELFGGYNIYREPQSLKMFKAIPNRLKPSLKKIAEQLPVGMR
GRSFIIRGCTPLEDRFVGNAKIFTDVEKEDILIPGSPDWKTSNIVKQLYAEARNANYDDV
TTMQYVDIHTWLRGDILVKADKMTMAHSLELRVPFLDPQVFDVASKIPLRGKIQGTQTKL
WLREALADIVPNHVLHRKKLGFPVPIRHWLKDEMYDWARSWIQASNTDHLFHKKNCLQLL
EDHRLGKIDASRKIWTILTYMIWHHQYIEKKGEDDSSVYNIS
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggtttgtgggaatggtaagtaataattctgagtcattgaatcagcttccttta
gaggaaatgatgaatgtcatcgcgcaccgcgggcctgatgatgctggtacatttggtgat
caacatgttcgactggggtttcgtagactcagtattgtagacattgaaaaagggcatcaa
ccaatgtgctacgccgaggaccgatacacgattatttttaacggagagatctataatgcg
cctgagcttcgcgagcaattaatagacgcaggattaagctttcaaacgaactctgatacg
gaagttattcttgcagcctatcattattatggagatgattgtgtaagcaagctgcgcggg
atgttctcatttatcatctgggataaaaaagagtcgaggttgtttggggcgcgtgatcca
tttggtattaaacctttattttatcgtgagttgagagatgggacaatcatctttgcttct
gagaaaaaatcattatttttccttaacgaaccgacttatattgaaggagaagctgccttt
cattatttaacattccagtatgcacctgaaccacacactgtgactgcaaacatcatgaag
gtcgaacctggacattctttttcatggaagccatatgaatccttaagaatgtacacctat
ttcactcctacgtttattgaaaaagaaaaaaataggaagtggttagctcctttcaaaaga
aatgcactaaaaatagaaaaagatgagatgacatcatcgatcaaaaatacattaatagac
tctgtaaaatgccatatgcgctctgatgtacctgttggtgcgttcttatctggcggtatc
gattcatctgccattgttgcaattgctaaacagttccatcctaatttgaatacatttacg
gcagagtttgatagagatggctttagtgaaggagatgtagcggaagaaactgcgaaggca
ttggatgtgaaccatacacgggtgaaaatttcagttgaagatgtcatgaaggagcttcca
aaaattttgtggcaaatggatgagccagtagcagaccctgctgcgattccactgtatttt
gtcgctcaggaagcgagtcgtcatgtaaccgtcgtgctttcaggagaaggtgcagatgaa
ctatttggcggctacaacatttaccgtgaaccacaatcattaaagatgtttaaggctatt
ccaaatcgccttaaaccatcactcaaaaaaatagcggaacaactgccagtcggaatgcgc
ggtagaagcttcatcattcgtggatgtacaccgcttgaggatcgcttcgtcggtaatgct
aaaatttttaccgatgtagaaaaagaagacattcttatccctggctctcccgattggaaa
acgagcaatattgtaaaacagctttatgcagaagcaagaaacgcgaattacgatgatgta
acaacgatgcaatacgtcgacattcatacgtggcttcgcggtgatattttagtaaaagca
gacaaaatgacaatggcgcattcgttagagctccgtgtaccgtttttagatccacaagtt
tttgacgtagcttcaaaaattccgcttcgcggtaaaatacaaggtacacaaacaaagctc
tggcttcgtgaagcattagcagacatcgttcctaaccatgtccttcatcgaaaaaaactc
gggttccccgtaccaattcgacactggctgaaggatgaaatgtacgattgggcaagaagc
tggatacaagcaagcaatacagaccacttatttcacaagaaaaactgcttgcagctgtta
gaggatcatcgactaggaaaaatagatgccagtcgtaaaatatggacgatactcacttac
atgatctggcaccatcaatacatcgagaaaaaaggcgaagatgattcatctgtttataat
attagttga

DBGET integrated database retrieval system