KEGG   Bacillus cellulosilyticus: Bcell_3884Help
Entry
Bcell_3884        CDS       T01389                                 

Definition
monoacylglycerol lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bco  Bacillus cellulosilyticus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4219422..4220225
Genome map
AA seq 267 aa AA seqDB search
MKICFRKGTSVMNHPSIIQGAEAFHLKGNDVGILLCHGFVGTPQSMETIGRKFAAKGFTV
RAPRLTGHGTDPYDFEKATYHDWITDLEENYLELKKTCSQIFVVGQSMGGLLALIIAGRF
KDIAGVITLNVAYEVPGLEMYRNKISPRFIEESAPDIKNKNVHEITYPYIPITAINELLS
VAQYTKQHIHQVECPVLLFRSSVDHVVPPESTNDAYDQLQTTQKEIITLTNSYHVASMDY
DNEKIINDSVTFISKTTRQQGQVPCLI
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttgttttagaaaggggacttcagttatgaatcatccatcaattattcaaggg
gccgaggcttttcatttgaaggggaatgatgttggtatcttattatgccacgggtttgtt
ggtacgccgcaaagcatggagacaatcggtagaaaatttgccgcgaaaggttttacagtg
agagcgccacgacttacagggcatggtaccgatccttatgactttgaaaaagcaacatat
catgactggataactgatctagaagaaaattatcttgagttgaaaaaaacgtgttcccag
atttttgtcgttggtcaatcgatgggaggccttttagcccttatcatagctggtagattc
aaagatatagcaggtgtcattacattaaacgtggcatacgaagttccaggattagaaatg
tacagaaataaaatctcgccgaggtttatagaggaatccgcacctgatataaaaaataaa
aatgttcatgaaattacttatccatacattcctattacagcaatcaacgaattactcagt
gttgcacaatacacaaaacagcatattcaccaggtggaatgtcctgttttactattccga
tcatccgtagaccatgtcgtacctccagagagtacgaatgatgcttatgatcaattacaa
acaacacaaaaagaaatcattaccttaaccaattcctatcacgtcgcttccatggactat
gataatgaaaaaatcatcaacgatagcgttacattcatatcgaagacaacaagacagcag
ggacaggttccttgtcttatctag

DBGET integrated database retrieval system