KEGG   Bacillus cellulosilyticus: Bcell_4102Help
Entry
Bcell_4102        CDS       T01389                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bco  Bacillus cellulosilyticus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bco00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bco00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4420700..4421992)
Genome map
AA seq 430 aa AA seqDB search
MEKLLIEGGYPLEGTVQISGAKNSAVALIPAAILADSPVTIDNLPNISDVETLAELLEEI
GGSTKLEDDTLVIHPENMFAMPLPNGRVKKLRASYYMMGAMLGKFKKAVIGLPGGCNLGP
RPIDQHIKGFEALGAKVTNEQGAIYLQADELIGARIYLDVVSVGATINIMLAAVRAKGKT
IIENAAKEPEIIDVATLLTNMGANIKGAGTNVIRITGVDELHGCRHSIIPDRIEAGTFMI
LAAAMGRSVLIDNIIPDHVESLSAKLREMGVFIEEADDSVFIRAREDNELTPIDVKTLVY
PGFATDLQQPFTSLLTKVPGSSMVTDTIYNARFKHIDELRRMGANIKVEGRSALVNGGTP
LQGAKVRASDLRAGAALVVAGLMAKGITEITGVEHIDRGYGGLEEKLKGLGAKIWRENLN
EKELAELENI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagctattgatcgaaggtggttatccattagaaggaacagtacaaatcagtgga
gcaaaaaatagtgctgttgcactgattccagcagctattttagcagattccccggtgacg
atcgataacctccctaatatttcagatgttgaaacgttagcagagttgttagaagaaata
ggtggtagcacgaagcttgaggatgatacgcttgtcattcatcctgaaaatatgtttgcc
atgccacttccgaatggacgggtaaaaaaattgcgcgcctcttattatatgatgggggct
atgcttggtaaatttaaaaaagctgttattggattacctggtggttgtaaccttggtcca
aggcccattgatcaacatataaaaggtttcgaagcacttggtgcaaaagtaacaaatgaa
caaggagctatatacctccaggcagacgagcttattggagcaagaatatacttagatgtt
gttagtgtaggagcaacgattaatattatgcttgctgcagttcgagcaaaagggaaaaca
attattgaaaatgctgcaaaagagcctgaaattattgatgttgccacattattaacgaat
atgggagcaaatattaaaggtgcggggacgaacgttattagaataacgggtgttgacgag
cttcatggttgtaggcactctattattcctgacagaatcgaagctggtacatttatgata
ttggcagcagcaatgggacgatccgttctcattgacaatattattccggaccacgtagag
tcattaagcgctaagcttcgtgaaatgggtgtctttatcgaagaagcagatgactcggta
tttatacgtgcgcgtgaggacaacgaattaacgccaatcgatgtaaaaacgcttgtatat
cctgggttcgcaacagacctacagcaaccatttacgagtctattaacgaaagtacctgga
tcaagtatggtgacagatacaatatataatgcaagatttaaacatattgatgagcttcgg
agaatgggagcgaacattaaagtggagggccgttcagcactcgtgaatggaggaacgcct
ctacaaggagcaaaggtgcgtgccagtgaccttcgtgcaggagctgcgcttgttgtcgca
ggattaatggcaaaagggataactgagatcacaggtgtcgagcatattgacagaggttac
gggggattagaagaaaagctaaaaggtttaggagcaaaaatatggcgtgaaaacctaaat
gagaaggaattagccgagctagaaaacatttaa

DBGET integrated database retrieval system