KEGG   Bacillus cellulosilyticus: Bcell_4172Help
Entry
Bcell_4172        CDS       T01389                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00260  Glycine, serine and threonine metabolism
bco00750  Vitamin B6 metabolism
bco01100  Metabolic pathways
bco01110  Biosynthesis of secondary metabolites
bco01120  Microbial metabolism in diverse environments
bco01230  Biosynthesis of amino acids
Module
bco_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcell_4172
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bcell_4172
Enzymes [BR:bco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bcell_4172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADU32399
UniProt: E6TY80
Position
4497583..4498647
Genome map
AA seq 354 aa AA seqDB search
MKRWQGLIGEYEQFLPVNEQTPRLSLSEGNTPLIPLENLSKKWGIELHVKYEGANPTGSF
KDRGMVMAVAKAKEEGSEAIMCASTGNTSAAAAAYAARAGLRCIIVIPDGKIAMGKLAQA
VMYGAEIYAIEGNFDNALQMVRNLAEVSPITLVNSVNPYRIEGQKTAAFEVCDQLGTAPD
VLAIPVGNAGNITAYWKGFKEYDEQKQTGLPQMRGFEAEGAAAIVRNEVIENPETIATAI
RIGNPASWDKAVDAATSSNGAIDSVTDDEILAAYKLLAQEEGVFAEPASCASIAGVIKDI
DAGKIKKGAKVVAVLTGNGLKDPNCAIDTAMFKPVVLPNEEEVVFDHILGRVNS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaagagatggcaagggttaataggagaatatgaacaatttttaccggtgaatgaacaa
acaccgaggctttctttaagtgaagggaatacacctcttataccgttagaaaacctttct
aaaaagtggggcattgagctccacgtcaaatatgaaggcgctaaccctaccggttcattc
aaggatcgaggaatggtaatggctgtggctaaagcgaaggaagaaggtagcgaagcaatt
atgtgtgcttccacagggaacacatccgctgctgctgctgcatacgctgcacgtgccggt
cttagatgcatcatcgtaattcctgatggaaaaattgcgatgggtaagcttgcacaagcg
gtcatgtatggcgcggaaatctatgcaatagaaggaaactttgacaacgccttacaaatg
gttagaaatttagctgaagtttctcctattacgctagtaaactctgtaaatccttatcgt
atcgaaggtcaaaaaacagctgcctttgaagtgtgtgaccagttaggaacggctcctgat
gtacttgcaattccagttggtaacgcaggaaacatcacagcatattggaaaggtttcaaa
gaatacgatgagcagaagcaaactggacttccacaaatgcgtggattcgaagcggagggc
gcggctgcaatcgttcgtaatgaagtgatcgagaaccctgagacgattgcaacagccatt
cgaattggaaatccagcgagctgggataaagcggtagatgctgctacatcttccaatggt
gccatcgattctgttacagatgacgaaattttagctgcttataagctcctcgctcaagaa
gagggcgtgtttgcagaaccagcttcatgtgcatcgattgccggagtgataaaggatatt
gatgcaggaaaaattaagaagggggcaaaggtcgtagcagttttaactggtaatggactc
aaggaccctaactgcgcgattgatactgctatgtttaaacctgtcgtccttccgaatgaa
gaagaagttgtttttgatcatattctaggacgtgttaactcatga

DBGET integrated database retrieval system