KEGG   Bacillus cellulosilyticus: Bcell_4172Help
Entry
Bcell_4172        CDS       T01389                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bco  Bacillus cellulosilyticus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcell_4172
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcell_4172
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bcell_4172
Enzymes [BR:bco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bcell_4172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4497583..4498647
Genome map
AA seq 354 aa AA seqDB search
MKRWQGLIGEYEQFLPVNEQTPRLSLSEGNTPLIPLENLSKKWGIELHVKYEGANPTGSF
KDRGMVMAVAKAKEEGSEAIMCASTGNTSAAAAAYAARAGLRCIIVIPDGKIAMGKLAQA
VMYGAEIYAIEGNFDNALQMVRNLAEVSPITLVNSVNPYRIEGQKTAAFEVCDQLGTAPD
VLAIPVGNAGNITAYWKGFKEYDEQKQTGLPQMRGFEAEGAAAIVRNEVIENPETIATAI
RIGNPASWDKAVDAATSSNGAIDSVTDDEILAAYKLLAQEEGVFAEPASCASIAGVIKDI
DAGKIKKGAKVVAVLTGNGLKDPNCAIDTAMFKPVVLPNEEEVVFDHILGRVNS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaagagatggcaagggttaataggagaatatgaacaatttttaccggtgaatgaacaa
acaccgaggctttctttaagtgaagggaatacacctcttataccgttagaaaacctttct
aaaaagtggggcattgagctccacgtcaaatatgaaggcgctaaccctaccggttcattc
aaggatcgaggaatggtaatggctgtggctaaagcgaaggaagaaggtagcgaagcaatt
atgtgtgcttccacagggaacacatccgctgctgctgctgcatacgctgcacgtgccggt
cttagatgcatcatcgtaattcctgatggaaaaattgcgatgggtaagcttgcacaagcg
gtcatgtatggcgcggaaatctatgcaatagaaggaaactttgacaacgccttacaaatg
gttagaaatttagctgaagtttctcctattacgctagtaaactctgtaaatccttatcgt
atcgaaggtcaaaaaacagctgcctttgaagtgtgtgaccagttaggaacggctcctgat
gtacttgcaattccagttggtaacgcaggaaacatcacagcatattggaaaggtttcaaa
gaatacgatgagcagaagcaaactggacttccacaaatgcgtggattcgaagcggagggc
gcggctgcaatcgttcgtaatgaagtgatcgagaaccctgagacgattgcaacagccatt
cgaattggaaatccagcgagctgggataaagcggtagatgctgctacatcttccaatggt
gccatcgattctgttacagatgacgaaattttagctgcttataagctcctcgctcaagaa
gagggcgtgtttgcagaaccagcttcatgtgcatcgattgccggagtgataaaggatatt
gatgcaggaaaaattaagaagggggcaaaggtcgtagcagttttaactggtaatggactc
aaggaccctaactgcgcgattgatactgctatgtttaaacctgtcgtccttccgaatgaa
gaagaagttgtttttgatcatattctaggacgtgttaactcatga

DBGET integrated database retrieval system