KEGG   Baudoinia compniacensis: BAUCODRAFT_156204Help
Entry
BAUCODRAFT_156204 CDS       T03106                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
bcom  Baudoinia compniacensis
Brite
Enzymes [BR:bcom01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     BAUCODRAFT_156204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 297 aa AA seqDB search
MDVVPNAPVLIPGWLPPSREHWQLIVYCWQFFPIFTAIQWFTTFYPQGKTSIESKINIPG
KWGWFLMEIWGMVVVDYCMLSIPQTVGLNSARSLPWANWTMVFAYNVHYVYRAIIAPLLL
NPTMSPIHPFVFVSAALWQVANGLSIGGWVAGYGPTTVFDWAGRLYTIEIGLVIMGWSFL
GNMFHDDDLREIRRSALKRQKAQAEKEGKPVEGVEKLYMLPKNGLFHYILYPHYLCEWFE
WAGFWMVGGWDCVPARTFLINEISTMLPRALQGRQWYIEKFGTEKVGNRKAVIPGLL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgtcccaaacgctccggtgctcataccaggatggctgccaccttcacgtgag
cactggcaactcatcgtctactgctggcagttcttccctattttcacggctatacaatgg
ttcacgacattttacccgcagggcaaaacctctatcgagagcaagatcaacattcccggc
aaatggggctggttcctcatggagatctggggcatggtggtcgtcgattactgcatgctc
agcatcccgcagacagtcggtttaaacagcgctcggtcgctaccgtgggcgaactggacc
atggtgtttgcctacaacgtgcattatgtctatcgcgccatcatcgcgcctctcttactt
aacccaaccatgtcgccgatccacccatttgtgttcgtctctgcagcgctgtggcaagtc
gctaacggactgtcaattggaggttgggtggccggctacggcccgaccaccgtgtttgac
tgggccggccgtttatacacgatcgaaatcggcctcgtgatcatgggctggagcttcctg
ggcaacatgttccacgacgatgatctacgagagatacggcgtagcgcactcaaacggcaa
aaagcgcaggcggagaaggaaggcaagcccgtcgaaggcgttgagaagctttacatgctt
cccaagaacggactgttccattacattctgtacccgcactatctttgtgagtggttcgaa
tgggctggtttctggatggtaggaggttgggactgcgtgccagccaggacgtttctgatc
aacgagatttccacaatgctaccgcgagcgctgcaaggcaggcagtggtacatcgagaaa
ttcggcacggaaaaggtgggcaaccggaaggcggtgataccgggtctgctgtga

DBGET integrated database retrieval system