KEGG   Baudoinia panamericana: BAUCODRAFT_31232Help
Entry
BAUCODRAFT_31232  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:bcom00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BAUCODRAFT_31232
Enzymes [BR:bcom01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     BAUCODRAFT_31232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9 DUF4366 Gram_pos_anchor
Motif
Other DBs
NCBI-GeneID: 19111424
NCBI-ProteinID: XP_007673543
JGI: Bauco1_31232
UniProt: M2MQA1
Position
Unknown
AA seq 357 aa AA seqDB search
MFASRLFRPAQQLSSHVRRYATEPPKSGGNNTLLYSALAVAAVGGGGGYYYYTQQPTGAS
PRKEQHGEGHESGAHGQPASKTEERNIPATTGGEIKGVKCFQGGEQGFVSLVLDHIENVN
HNTKKLRFKLDDDDSTSGLNVASALLTKYKGPEMEKPVVRPYTPTSDEDAKGFLDLVVKK
YPNGPMSTHLHDMSVGQRLDFKGPIPKYPWSPNKHDHIALVAGGTGITPMYQLARAIFKN
PEDKTKVTLVFGNVSEEDILLKHEFEELENNYPQRFRAFYVLDKPPEGWQQGKGFVTKEL
LQTVLPGPKDANVKVFVCGPPGMYKAISGPKKSPSDQGDLGGYLAELGYTKEQVYKF
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccagcagactcttccggccggcacagcagctgtcgagccacgtgcgccggtac
gcaaccgagccccccaaaagcggcggcaacaacaccctcctctactcagcccttgccgta
gcagccgtgggcggaggtggaggctactattactacacccaacagccgaccggtgcttct
ccgaggaaggaacaacatggcgagggtcacgagtcgggtgcccacggccaacccgccagc
aagaccgaagagcgcaacatccctgcaacgacgggcggtgagatcaagggggtgaagtgc
tttcagggcggggagcaaggcttcgtgagcctggtgttggatcacattgagaacgtcaac
cacaacacgaagaagttgcgcttcaagctggacgacgacgactcgacgagcgggctgaat
gtggcgagcgcgctgctcaccaagtacaagggcccggagatggagaagcctgtcgtcagg
ccgtacacgcccacaagcgatgaagacgccaaaggctttctcgaccttgttgtgaagaag
tacccgaacggacccatgtccactcatctccacgacatgagcgtcggccaacgccttgac
ttcaaaggcccaatcccaaaatacccgtggtcgcccaacaagcacgaccacatcgccctc
gtcgccggtggcacaggcataacgcccatgtaccagctcgcccgcgccatcttcaagaac
ccggaggacaagaccaaagtcacgctcgtcttcggcaacgtcagcgaggaggacatcctg
ctcaagcacgagttcgaggagctggagaacaactacccgcagcgattccgggcgttttat
gtcctcgacaagccgccggaggggtggcagcagggcaagggctttgtgacaaaggagttg
ttgcaaacggttctgcccggaccgaaggatgcgaacgtcaaagtgtttgtgtgcgggccg
ccgggaatgtacaaggccatctcgggcccgaagaagtcgccgagtgatcagggcgatttg
ggcgggtatctggcggagcttggatacacgaaggagcaagtgtacaaattctag

DBGET integrated database retrieval system