KEGG   Baudoinia compniacensis: BAUCODRAFT_34184Help
Entry
BAUCODRAFT_34184  CDS       T03106                                 

Definition
glycoside hydrolase family 30 protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bcom  Baudoinia compniacensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcom00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BAUCODRAFT_34184
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BAUCODRAFT_34184
Enzymes [BR:bcom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BAUCODRAFT_34184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 597 aa AA seqDB search
MASLVQAVLFTFATHTFAQSISDLGVSGGNGSRGGIGDGDHPVMHAQAYITDAMIPLAPN
TTRQLAQGTAPVLSRTNNSGTCGNFRFVVVDSTSNGARQQMVGFGHAWTDSAVDVFNTLQ
PAVLDQVMNDLFGQSGNNMGFMRHTIGSSDLSGAQYSYDDNGPSFNEGEPDPSLANFSLG
QYGTAMAQMIAKMGTYKGDVFLFGAPWSLPGWMKNNDLFIAGITNTPGGQYPLLNNSFNI
GYIPQAVEYFTKYIDAFAQYGVTINGLSLENEPLNYQGGYPTMYLDAADEANILNQGLGS
MLQQRGVLAMAYDHNTDQPVYPYRVLQGAPSYAHAVAWHCYQGPYPNYTVMADISRAFPG
TLQFMTECSNYLPAAGSVNFEVAENFIPPVQQGASGAAMWVMATDPDFGPHSPYGGCNGC
LGSIVVNSSTTYTKTNDYYMIGQFSRFVRRGSVNYNVLRGNEGSGATSNQFYVMSVQNPD
GSWAVVFMNNMGSDQDVVLSFTGQGNQFWEGVVPSQTVTTWLIPSQQVLNQVNGTKAAST
VPPYPFTNTTSIPLTGSTTIAVCNITTATTSSSSSSTSTTALPVPDTTHTIATTSMV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcctggtccaggcagtgctctttacattcgctacgcacacattcgctcaatcc
atctcagatcttggtgtatctggtggaaatggcagccgaggaggcatcggagacggtgac
cacccagtcatgcatgcccaggcatacatcacggacgccatgatcccactggcacccaac
actaccagacagctagcccaagggacagcacctgtactctctcgcactaacaacagcgga
acatgtggcaatttccgcttcgtcgtcgtcgattccaccagcaacggcgcaaggcaacag
atggttggctttggtcacgcgtggactgatagcgcagtggatgtgtttaataccctgcag
cctgccgtccttgatcaggtcatgaacgacctctttggtcaaagcggcaacaacatgggc
tttatgagacacaccatcggctcaagtgatctcagtggcgcgcagtactcgtacgacgac
aacggacctagcttcaacgaaggcgagccggatccaagtctcgcgaacttctcactcggc
cagtatggaacagcaatggctcaaatgattgcaaagatgggcacctacaagggtgacgtc
ttccttttcggcgctccgtggtcgttaccaggctggatgaagaacaacgatctattcatc
gctggaatcaccaatacgcctggaggacaatatccgttgctcaacaactctttcaatatt
gggtacatcccacaagctgtggagtacttcacgaagtacatcgacgccttcgcacagtac
ggtgttaccatcaacggtctgtcgctcgagaacgagcccttgaactaccagggtggctat
cctaccatgtacctcgacgctgccgatgaggcgaacatcctcaaccaaggtctaggaagt
atgcttcaacagcgaggagtgctcgcaatggcatacgaccacaacaccgatcagcctgtc
tatccgtaccgggtcttgcaaggagcaccgagctacgcccatgccgttgcatggcattgc
tatcaagggccgtatcctaactataccgtgatggcagacatttctcgcgccttcccaggc
actctacaattcatgaccgagtgctccaattacctcccggccgctggctcggtcaacttt
gaagtcgctgagaacttcatcccaccggttcagcagggtgcatctggcgctgcaatgtgg
gttatggccaccgaccccgactttggtccgcattcaccttacggaggatgcaacggctgc
ctcggaagcattgttgtgaattccagcacgacatacacgaagaccaacgactattacatg
attggccagttctctcgcttcgttcgcagaggttcagtcaactacaacgttttgcggggc
aacgagggtagcggcgcgacgagcaaccagttctacgttatgtcagtccagaacccggac
gggtcatgggctgtggtcttcatgaacaacatgggcagcgaccaagacgttgtgctttca
ttcactggtcaaggcaaccagttttgggaaggcgtggtgccgagccaaacagtgactacc
tggctcatcccgtcgcagcaggtactgaaccaggtgaacggaaccaaggctgcaagcact
gtacctccgtacccattcaccaacaccacctccattccgttgaccggatcaacgactatt
gctgtgtgcaacatcaccaccgcaacaacatcgagcagcagtagctctacgagcaccacg
gcactaccagtaccggataccacgcatacgattgctacaacgagcatggtgtaa

DBGET integrated database retrieval system