KEGG   Baudoinia compniacensis: BAUCODRAFT_97696Help
Entry
BAUCODRAFT_97696  CDS       T03106                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bcom  Baudoinia compniacensis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcom00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BAUCODRAFT_97696
Enzymes [BR:bcom01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     BAUCODRAFT_97696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 480 aa AA seqDB search
MANSSDRKELKASWKPKAEVPSLSLKDVAKHSSRNDLWIVVHGGVYNVTEYSRDHPGGLD
ALAEVGGTDATSAYEDVGHSEDAREIMQSLLVGHLEGAPKASDTSEDKTPKVQVVRASPN
GDGEQKTSSRLLGPRIELAAFAVGTAALVYFVRHTNLTIPSLPRSMDSKHSGSGGSFLQG
FLLASATAAVIGVASVRYLSNVVNFDVDFSKLPAHKTASEHVPSSDYPTGVLMPRTYRKF
ALREKVELSPNGIFRFVFDLPTPTSTLGLPIGQHITIRGDVEEHSVTRSYTPVSNNRDLG
RMELVIRIYPDGQLGKYLSALQPGDKVDIRGPKGAMRYRKGMSTHIGMVGGGTGITPLFQ
IIRAVCEDKTDNTKISLVYANRSEPDIMLRNRLDQFARDVPSKFQVYYVLDQPPASGWQG
GVGRVNKQILQERMPAVSDSTKILVCGPPPMVNATKNNLIDLGFKEPGSVSKMSDQIFCF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcaaactcttcagaccgtaaagagttgaaagcgagctggaagcctaaagctgaagtg
ccttcgctgtcgctgaaggacgttgcgaaacatagctcaaggaacgatctctggattgtc
gttcatggtggagtctacaatgtcacagaatactcgagagaccacccgggcggcttggac
gctctcgctgaagtagggggaacggacgcaaccagcgcatatgaggatgttgggcattct
gaagatgcaagagagatcatgcaatctttgctggtgggacaccttgaaggggcgccaaaa
gcgtcagatacatcggaagacaagacacccaaggttcaagttgttcgcgccagtccaaac
ggcgatggagaacagaagacatctagtcgtttgttgggccctaggatcgagctggcggcc
tttgctgtcggaacggctgcgctcgtctacttcgtccgccatactaacctaaccataccg
tctctcccccgctctatggactcgaagcattccggcagcggagggagctttttgcaagga
tttttgctcgcaagcgcaactgccgctgtgattggcgttgcatccgtccgctacttgtcc
aatgtcgtcaatttcgacgtcgacttctcgaagctgccagcgcacaagactgcgtcggag
catgttccttcttccgactaccctaccggcgtgcttatgccgcgaacttaccgcaagttc
gctctgcgagaaaaggtcgaactatctcccaacggaattttccgcttcgtattcgaccta
cctacacccacgtctacgctcggtcttcctatcggacagcatatcaccatccgcggcgac
gttgaggagcattctgtcacccgcagctataccccagtttcgaacaaccgtgaccttggg
aggatggaacttgtcattcgcatttacccagatggtcaactcggcaaatacctgtcagcg
ctgcaacctggggacaaagtcgacattcgcggacccaaaggcgccatgcgataccgtaaa
ggcatgagcacgcatattgggatggtcgggggagggacgggcatcacgcccttgttccag
atcatccgagccgtttgcgaggacaagacagacaatacgaaaataagtctagtctacgcg
aaccgatcagagcctgacatcatgctccgcaacaggcttgatcagtttgccagagacgtc
cccagcaagtttcaggtgtactacgtgctcgaccaaccgcctgcatccggctggcaaggt
ggagttggccgtgtcaataagcagatcttgcaagagaggatgccggcggtctctgacagt
accaagatcttagtttgcggcccgccccccatggtgaacgcaaccaagaacaatttgatc
gatttggggttcaaggagcccgggagtgtgagcaagatgagcgatcagatattctgcttt
tga

DBGET integrated database retrieval system