KEGG   Blattabacterium Cpu (Cryptocercus punctulatus): BLBCPU_010Help
Entry
BLBCPU_010        CDS       T01660                                 

Definition
dihydrolipoyllysine-residue acyltransferase (EC:2.3.1.-)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcp  Blattabacterium Cpu (Cryptocercus punctulatus)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLBCPU_010
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLBCPU_010
  Amino acid metabolism
   00310 Lysine degradation
    BLBCPU_010
Enzymes [BR:bcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BLBCPU_010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10152..11357
Genome map
AA seq 401 aa AA seqDB search
MSEYNLILPSMGESIAEATIIRWLKKEGDYIKKEDLLVEISTDKVDSEITSPVNGILKKK
LFSTNEVAKVGSSIAILEIEDKEIYLENKKRFYSPFVRTIAKQEGINFDELEFIEGTGKN
GIINKNDIIKYIKNKKEKKIVRKNDTILSPTYCIINNNQQNNEDENETIVEMDRIRKITS
SHMVTSKKISAHVTSFVEADVTNIVKWRDKMKDIFKKNTGEKLTLMSIFVECVVKAIKDF
PMINISVNGTNIIKKKNIHIGLAIALPNGNLIVPVIKNADSYSLGGLIKIINNLIKRAKS
NQLKPEETQGGTYTISNIGSFGNLFGTPIIHQPQVAIMGIGLIQKKLSVIEKPEGDFIGI
RHKIYLSHSYDHRVIDGILGGGFVKKVALYLEEYKCYTTII
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagtataatttaattcttccatccatgggtgaaagtatagctgaggctactatt
attcgttggttaaaaaaagaaggagattatataaaaaaagaagatttattagtagaaatt
tctacggataaagtagattcggaaattacttctccagtaaatggaatactgaaaaaaaaa
ttattttctacaaatgaagtagctaaagtaggaagttctatagctattttagaaatagaa
gataaagaaatttatctagaaaataaaaaacgattttattccccttttgtacgtaccatt
gctaaacaagaagggattaattttgatgaattagaatttatagaaggtactggaaaaaat
ggaataattaataaaaatgatattataaaatatattaaaaataaaaaagaaaaaaaaata
gttaggaaaaatgatactattttatctcctacttattgtatcataaataataatcagcag
aataacgaagatgaaaacgaaactatagtagaaatggatagaattcgtaaaataacttca
tctcatatggttactagtaaaaaaatatctgctcatgtaacatcttttgttgaagctgat
gttacaaacatagtcaaatggagagataaaatgaaggatatttttaagaaaaatacagga
gaaaaattgactttgatgtctatatttgtagaatgtgtagtgaaagctataaaagatttt
cctatgataaatatatctgtcaatggaactaatattataaaaaaaaaaaatattcatata
ggattagctatagcattacctaatggtaatctcattgttcctgtgattaaaaatgcagat
tcttatagtttggggggattaatcaaaattatcaataatttaataaaaagagctaaatct
aatcaattaaaacctgaagaaactcaaggaggtacctatactattagtaatataggaagt
tttggaaatctatttggaactcctattatacatcaacctcaagttgctattatgggaata
ggattaatacaaaaaaaattatctgttatagaaaaaccagaaggagattttattggaata
agacataagatttatttatctcattcttatgatcatcgtgtaatagatggtatcctcgga
ggtggatttgttaaaaaagttgccttatatttagaagaatataaatgttatacaacaata
atatga

DBGET integrated database retrieval system