KEGG   Blattabacterium Cpu (Cryptocercus punctulatus): BLBCPU_010Help
Entry
BLBCPU_010        CDS       T01660                                 

Definition
(GenBank) dihydrolipoyllysine-residue acyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcp  Blattabacterium Cpu (Cryptocercus punctulatus)
Pathway
bcp00020  Citrate cycle (TCA cycle)
bcp00310  Lysine degradation
bcp01100  Metabolic pathways
bcp01110  Biosynthesis of secondary metabolites
bcp01120  Microbial metabolism in diverse environments
bcp01130  Biosynthesis of antibiotics
bcp01200  Carbon metabolism
Module
bcp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLBCPU_010
  Amino acid metabolism
   00310 Lysine degradation
    BLBCPU_010
Enzymes [BR:bcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BLBCPU_010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AEU09081
UniProt: G8LR58
Position
10152..11357
Genome map
AA seq 401 aa AA seqDB search
MSEYNLILPSMGESIAEATIIRWLKKEGDYIKKEDLLVEISTDKVDSEITSPVNGILKKK
LFSTNEVAKVGSSIAILEIEDKEIYLENKKRFYSPFVRTIAKQEGINFDELEFIEGTGKN
GIINKNDIIKYIKNKKEKKIVRKNDTILSPTYCIINNNQQNNEDENETIVEMDRIRKITS
SHMVTSKKISAHVTSFVEADVTNIVKWRDKMKDIFKKNTGEKLTLMSIFVECVVKAIKDF
PMINISVNGTNIIKKKNIHIGLAIALPNGNLIVPVIKNADSYSLGGLIKIINNLIKRAKS
NQLKPEETQGGTYTISNIGSFGNLFGTPIIHQPQVAIMGIGLIQKKLSVIEKPEGDFIGI
RHKIYLSHSYDHRVIDGILGGGFVKKVALYLEEYKCYTTII
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagtataatttaattcttccatccatgggtgaaagtatagctgaggctactatt
attcgttggttaaaaaaagaaggagattatataaaaaaagaagatttattagtagaaatt
tctacggataaagtagattcggaaattacttctccagtaaatggaatactgaaaaaaaaa
ttattttctacaaatgaagtagctaaagtaggaagttctatagctattttagaaatagaa
gataaagaaatttatctagaaaataaaaaacgattttattccccttttgtacgtaccatt
gctaaacaagaagggattaattttgatgaattagaatttatagaaggtactggaaaaaat
ggaataattaataaaaatgatattataaaatatattaaaaataaaaaagaaaaaaaaata
gttaggaaaaatgatactattttatctcctacttattgtatcataaataataatcagcag
aataacgaagatgaaaacgaaactatagtagaaatggatagaattcgtaaaataacttca
tctcatatggttactagtaaaaaaatatctgctcatgtaacatcttttgttgaagctgat
gttacaaacatagtcaaatggagagataaaatgaaggatatttttaagaaaaatacagga
gaaaaattgactttgatgtctatatttgtagaatgtgtagtgaaagctataaaagatttt
cctatgataaatatatctgtcaatggaactaatattataaaaaaaaaaaatattcatata
ggattagctatagcattacctaatggtaatctcattgttcctgtgattaaaaatgcagat
tcttatagtttggggggattaatcaaaattatcaataatttaataaaaagagctaaatct
aatcaattaaaacctgaagaaactcaaggaggtacctatactattagtaatataggaagt
tttggaaatctatttggaactcctattatacatcaacctcaagttgctattatgggaata
ggattaatacaaaaaaaattatctgttatagaaaaaccagaaggagattttattggaata
agacataagatttatttatctcattcttatgatcatcgtgtaatagatggtatcctcgga
ggtggatttgttaaaaaagttgccttatatttagaagaatataaatgttatacaacaata
atatga

DBGET integrated database retrieval system