KEGG   Blattabacterium sp. (Cryptocercus punctulatus): BLBCPU_058Help
Entry
BLBCPU_058        CDS       T01660                                 

Gene name
rocF
Definition
arginase family protein (EC:3.5.3.1)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bcp  Blattabacterium sp. (Cryptocercus punctulatus)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BLBCPU_058 (rocF)
Enzymes [BR:bcp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BLBCPU_058 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(57864..58754)
Genome map
AA seq 296 aa AA seqDB search
MKIIFFYEKKKLLLEFLKKYATLEKSKIVLIPVPYDYTGTWRKGSKKGPKAFLSASEHME
LYDIETNSEVYKRGIYISYPIINYSFSSKKMIEQVYNITKKYLFKKKFVTLIGGIHSISI
GSIRAFGEKFPDMSILHMDAHADLRPKYNGDPYNHACSMYEASKKFPIIQIGIRSMNILE
KRYIQNDNIFYFHEIYQNDLWMKKAIQRLSKNVFISIDIDVFDPSIAPSTGTPEPGGFFW
YEILKFLKMVFENKQIIGFDIVELLPNEKDFSTDFLSVKLYYKLLSYKYELIYSPL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaataatatttttttatgaaaaaaaaaaacttttgctggaattcctaaaaaaatat
gctactcttgaaaaatctaaaatagtccttattccagttccatatgattatacaggtacg
tggagaaaaggttctaaaaaaggtcctaaagcatttttatctgcatcagaacatatggaa
ttatatgatatagaaactaattctgaagtttataaaagaggtatatatatatcttatcct
ataattaattattcattttcttccaaaaaaatgatagaacaagtatataatattactaaa
aaatatctttttaaaaaaaaatttgtaactctaattgggggtatccattctatatctata
ggtagtattcgagcatttggagaaaaattccctgatatgagtattctacacatggatgca
catgccgatttacgtcctaaatacaatggagatccttataatcatgcttgttctatgtat
gaagcttcaaaaaaatttccaattatacaaatagggattcgaagcatgaatatactagag
aaaaggtatatccaaaatgataatattttttattttcatgaaatatatcaaaatgattta
tggatgaaaaaagcgattcaaagattatctaaaaatgtatttataagtatagatatagat
gtttttgatccaagtatagccccttctacaggaactccagaaccaggaggttttttttgg
tacgaaattttaaaatttttaaaaatggtttttgaaaataaacaaattataggttttgat
attgttgaacttttaccaaatgaaaaagatttttctacagattttttatctgttaaactt
tactataaattattatcatataaatacgaattaatttattctccattatga

DBGET integrated database retrieval system