KEGG   Blattabacterium Cpu (Cryptocercus punctulatus): BLBCPU_090Help
Entry
BLBCPU_090        CDS       T01660                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acyltransferase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcp  Blattabacterium Cpu (Cryptocercus punctulatus)
Pathway
bcp00010  Glycolysis / Gluconeogenesis
bcp00020  Citrate cycle (TCA cycle)
bcp00620  Pyruvate metabolism
bcp01100  Metabolic pathways
bcp01110  Biosynthesis of secondary metabolites
bcp01120  Microbial metabolism in diverse environments
bcp01130  Biosynthesis of antibiotics
bcp01200  Carbon metabolism
Module
bcp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLBCPU_090 (aceF)
   00020 Citrate cycle (TCA cycle)
    BLBCPU_090 (aceF)
   00620 Pyruvate metabolism
    BLBCPU_090 (aceF)
Enzymes [BR:bcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BLBCPU_090 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEU09157
UniProt: G8LRD4
Position
complement(94680..95840)
Genome map
AA seq 386 aa AA seqDB search
MAEIIFMPQLSDTMQEGTVIKWNKKVGDQVSEGDILAEIETDKAIQDFELDVSGYLLFIG
VKEGETTRVNDILAIIGEKGEDINSLIENSNFFLKKEEKNNLKKEKKCRIFISPLAKKIA
KKIGISINKIKGSGKNNRIIKRDIEAYEEKLIRKSKDPKEDKRINISSMRKKIAEHLIYS
KFTAPHYYLFIEINAEKMINLRKNLNDKLSKEEKISFNDIIIKAVTISLKKYPNLNVSWK
EKEIIYHSYINIGIAVAIKDGLIVPVIKNADKKSLLQISQEIKYKVLCSKSRKIQPEELE
NSTFTVSNLGMYGIEFFTSIINLPNSSILSVGSIIEKPIIKDSKIIIGNIMKVTLSCDHR
IIDGATGSNFISFLKEILEDPIIILI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaataatattcatgcctcaattaagcgataccatgcaggaaggtactgtaatc
aagtggaataaaaaagtaggagatcaagtatcagaaggagatattttagcggaaattgaa
accgataaagcaattcaagattttgaacttgatgtaagtggttatttactttttattggt
gtaaaagaaggagaaacaacccgtgttaatgatatattagctattattggggaaaaagga
gaagatataaattcattaatagaaaactctaacttttttttaaaaaaagaagaaaaaaat
aatcttaaaaaagaaaaaaaatgtagaatttttatttctcctttagcaaaaaaaatagca
aaaaaaataggaatttctataaataagattaaaggaagtggaaaaaataatcgtattatt
aaaagagatattgaagcttacgaagaaaaattaataagaaaatcaaaagatccaaaagaa
gataaacgaataaatatttcttctatgaggaaaaaaatagcagaacatttaatatattcc
aaatttacagctccacactattatctttttatagaaattaatgcagaaaaaatgattaat
ttgagaaaaaatttaaatgataaactttctaaagaagaaaaaatatcttttaatgatatc
attattaaagcagtaactatatctttaaaaaaatatccaaatttaaatgtttcttggaaa
gaaaaagaaattatataccattcctatattaatattggcattgcagtagctataaaagat
ggtttaattgttccagtaattaaaaatgctgataaaaaatcattattacaaatttctcaa
gaaataaaatataaagttttatgttcaaaatcaagaaaaatacaaccagaagaattagaa
aatagcacatttacagtttcaaatttaggaatgtatggaattgaattttttacttctatt
attaatcttcctaattcttctattctatctgtaggatctattatagaaaaacctatcatt
aaagattccaaaattataatcggaaatattatgaaagttactttatcttgtgatcataga
attatagatggtgctacaggtagtaattttatttcttttttaaaagaaatattagaagat
ccaataatcatattaatttaa

DBGET integrated database retrieval system