KEGG   Blattabacterium Cpu (Cryptocercus punctulatus): BLBCPU_094Help
Entry
BLBCPU_094        CDS       T01660                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bcp  Blattabacterium Cpu (Cryptocercus punctulatus)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BLBCPU_094 (folP)
Enzymes [BR:bcp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BLBCPU_094 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(99117..99947)
Genome map
AA seq 276 aa AA seqDB search
MTINCAGTLFSFKEPKVMGIVNLTPDSFYDGGKFNSELSVLKHVENLLNEGSDFIDIGGC
STRPGSKYLTVEEEIKRVIKPIRSIIKKFPNVRISIDTFRSEIARIAVEEGAIMINDISG
GMLDPKMFSLLSKLKIPYILNHMKGTPENMQKNPYYYNIIIEINNFFAKKIFLLKKYGIN
DIILDPGFGFGKTEKHNFQLLKNLSLLGFEDHLILIGISRKSMIHNILNISSKESMNATS
IIHTLALLKKIKLLRVHDVKEAIECIKLVQYYRKIF
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaattgtgcaggaactttattttcttttaaagaaccaaaagtgatgggaata
gttaatttaactcctgattctttttatgatggaggtaagtttaattctgaattaagtgta
ttaaaacatgtggaaaatctattaaatgaaggatcagatttcatagatattgggggatgt
tctactcgtccaggatctaaatatctaacagtagaagaagaaataaaacgtgttataaaa
cctattcgttcaataataaaaaaatttccaaatgttcgaatatctatagatacttttcga
agtgaaatagcaagaattgctgtagaagaaggagctataatgatcaatgacatatctgga
ggtatgttagatccaaaaatgttttctttattatcgaaacttaagataccatatatatta
aatcacatgaagggaactccagaaaatatgcaaaaaaatccatattattataacattatt
atagaaataaataatttttttgctaaaaaaatttttttattaaaaaaatatggaattaat
gatatcattttagatccaggatttggttttggaaaaactgaaaaacataatttccaatta
ttaaaaaatttatctttactgggatttgaggatcatttaattttaatagggatttctaga
aaatctatgattcataatattcttaatatttcttctaaagaatctatgaatgcaacttct
atcattcatacattagctcttttaaaaaaaataaaattattacgtgttcatgatgtaaaa
gaagctatagaatgtataaaattagtacaatattatagaaaaattttctaa

DBGET integrated database retrieval system