KEGG   Blattabacterium sp. (Cryptocercus punctulatus): BLBCPU_127Help
Entry
BLBCPU_127        CDS       T01660                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bcp  Blattabacterium sp. (Cryptocercus punctulatus)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bcp00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bcp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(134022..135329)
Genome map
AA seq 435 aa AA seqDB search
MASFKIEGGNFLKGEIKPQGAKNEALQVLCAVLLTSEKIRIKNIPEIGDVQCLIQILKNL
GVIIKKNNIGDYTFQAKEIYIEYLNTKKFFIEYGQSIRGSLMIAGPLLARFGKVCMPIPG
GDRIGRRRLDIHLRGFESLGSQIVYKENQYFYIYSKYLTGKYLLLEEASVTGTANIIMAA
TLAKGKTTIYNAACEPYIQQLCRLLNRMGSKIKGIGSNLIHIIGVTELSGCSHTILPDMV
EIGSWIGLAAITSSEIKIRNVSWKNLGIIPNTFKKMGIKLEKENDDIYIPSQKYYRIKKL
LNNAILTISDAPWPGLTPDLLSILTVVATQAKGSVLIHQKMFESRLFFVDKLIEMGAQII
LCDPHRATIIGLNHQSYLRGSILNSPDIRAGIALLIAALSAKGTSIIKNIEQIDRGYENI
DQRLRILGAKISRIV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttttaaaatagaaggtggaaattttttaaaaggggaaataaaaccacaaggt
gcaaaaaatgaagctttacaagttttatgtgcagttttattaacatcagaaaaaataaga
ataaaaaacattccagaaataggagatgttcaatgtttaatacaaattcttaaaaattta
ggagttataataaaaaaaaataatattggagattatacttttcaagcaaaagaaatttat
attgagtatttaaacacaaaaaaattttttattgaatatggacaatctattagaggatct
ctaatgattgcaggtcctttgttagctcgatttggaaaagtatgtatgccaattcctgga
ggggacaggattggtcgtagacgattggatattcatttaagaggatttgaatccttaggt
agtcagatagtttataaagaaaatcaatatttttatatttattccaaatatttaacagga
aaatatcttcttttagaagaagcttctgtaacaggaacagctaatattatcatggcagct
accttagcaaaaggaaaaacaactatttataacgcagcttgtgaaccttatattcaacaa
ttatgtagattattgaatagaatgggatcaaaaataaaaggaataggttctaatttaatt
catattatcggagttacagaattaagtggatgttcacatactattttacctgatatggta
gaaattggaagttggataggattagcagcaattactagttccgaaataaaaattagaaat
gttagttggaaaaatttaggaattattccaaatacatttaaaaaaatggggataaaatta
gaaaaagaaaatgatgatatttatattccatctcaaaaatattatagaataaaaaaatta
ttaaataatgctatattaacaatttctgatgcaccatggccaggattaactcccgattta
ttaagtattttaacagttgtcgcaactcaagcaaaaggaagtgttttaattcatcaaaaa
atgttcgaaagtagattattttttgtagataaactaattgaaatgggtgcacaaataata
ttatgtgatcctcatagagcaactattattggattaaatcatcaatcttatttgcgaggt
tcgatattaaattctccggatataagagcaggaattgcacttttaatagcagcactttct
gctaaaggtactagtataataaaaaatatagaacaaatagatagaggatatgaaaatatt
gatcaacgattacgtattttaggagcaaaaatttccagaatagtataa

DBGET integrated database retrieval system