KEGG   Blattabacterium sp. (Cryptocercus punctulatus): BLBCPU_346Help
Entry
BLBCPU_346        CDS       T01660                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.1.22.4)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bcp  Blattabacterium sp. (Cryptocercus punctulatus)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bcp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
351033..351635
Genome map
AA seq 200 aa AA seqDB search
MITHLRGKLIEKNQSYLIIDCNGIGYYIHISLSTYSSFSTKKEGEEIYIYTYLFIKEHQH
VLYGFFDRIERKIFSDLISVNGIGPNSAITLLSSLTPYEIEQSIFNEEIEVFKRVKGIGI
KTAHRIIIELKDKIGIFSKKEKNVTLFDKNTPSIIKKEALSALIVLGFSTKESKKVLEDI
LEKNPRFTVENLIKESIKKL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgataacacatttaagaggaaaattgatcgaaaaaaatcaatcctatttaatcatagat
tgtaacggaatcggatattatattcatatatccttgtccacttattcttctttttctact
aaaaaagaaggagaggaaatctatatatatacttatctatttataaaggaacatcaacat
gttttatatggtttttttgatagaatagaaagaaaaatattttctgatttgatatctgta
aatggaataggaccaaattctgctataacattattatcttcattaactccatatgaaata
gaacaatctatctttaatgaagagatagaagtatttaaaagggtaaaggggattggtata
aaaacggctcatagaattataatagaacttaaagataaaataggaattttttctaaaaaa
gaaaaaaacgttacattattcgataaaaatacaccatccattataaaaaaagaagcttta
agtgctttgattgtattgggtttttctactaaagaatctaaaaaagttttagaagatatt
ttagaaaaaaatccaagatttactgtagaaaatttaataaaagaatctataaaaaagtta
taa

DBGET integrated database retrieval system