KEGG   Blattabacterium Cpu (Cryptocercus punctulatus): BLBCPU_346Help
Entry
BLBCPU_346        CDS       T01660                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.1.22.4)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bcp  Blattabacterium Cpu (Cryptocercus punctulatus)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BLBCPU_346 (ruvA)
Enzymes [BR:bcp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BLBCPU_346 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
351033..351635
Genome map
AA seq 200 aa AA seqDB search
MITHLRGKLIEKNQSYLIIDCNGIGYYIHISLSTYSSFSTKKEGEEIYIYTYLFIKEHQH
VLYGFFDRIERKIFSDLISVNGIGPNSAITLLSSLTPYEIEQSIFNEEIEVFKRVKGIGI
KTAHRIIIELKDKIGIFSKKEKNVTLFDKNTPSIIKKEALSALIVLGFSTKESKKVLEDI
LEKNPRFTVENLIKESIKKL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgataacacatttaagaggaaaattgatcgaaaaaaatcaatcctatttaatcatagat
tgtaacggaatcggatattatattcatatatccttgtccacttattcttctttttctact
aaaaaagaaggagaggaaatctatatatatacttatctatttataaaggaacatcaacat
gttttatatggtttttttgatagaatagaaagaaaaatattttctgatttgatatctgta
aatggaataggaccaaattctgctataacattattatcttcattaactccatatgaaata
gaacaatctatctttaatgaagagatagaagtatttaaaagggtaaaggggattggtata
aaaacggctcatagaattataatagaacttaaagataaaataggaattttttctaaaaaa
gaaaaaaacgttacattattcgataaaaatacaccatccattataaaaaaagaagcttta
agtgctttgattgtattgggtttttctactaaagaatctaaaaaagttttagaagatatt
ttagaaaaaaatccaagatttactgtagaaaatttaataaaagaatctataaaaaagtta
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system