KEGG   Blattabacterium Cpu (Cryptocercus punctulatus): BLBCPU_585Help
Entry
BLBCPU_585        CDS       T01660                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bcp  Blattabacterium Cpu (Cryptocercus punctulatus)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BLBCPU_585 (folK)
Enzymes [BR:bcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BLBCPU_585 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(605025..605570)
Genome map
AA seq 181 aa AA seqDB search
MSLLKEHNVFLLQGSNKENRKKYLDESLVLISKKIGKIIQKSSYFESEAWSMNKDTYPFY
NRALHVKTFYSPIDILEKIYDIEFFINKKSIMNKKVKDQSSQNKKFYKDRKIDIDILFYD
QIIIHSSILTIPHSLLHLRKFVLVPMCEILPKKYHPIFNITLLEILGICEDKLKIKKIEF
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtctttattgaaagagcacaatgtttttttattacaaggaagtaataaagaaaataga
aaaaaatatttagatgaatctttagttttaatttccaaaaaaattggaaaaattattcaa
aaatcttcttattttgaaagtgaagcttggagtatgaacaaagatacatatcctttttac
aatagggctttacatgtaaaaacattttattctcctattgatattttagaaaaaatttat
gatatcgaattttttataaataaaaaatctataatgaataaaaaagtaaaagatcaatca
tcccaaaataaaaaattttataaggatagaaaaattgatatagatattttattttatgat
caaattataatacatagttctattttaactattccacattctttattacatcttcgaaaa
tttgttttagttcctatgtgtgaaattttaccaaaaaaatatcatcctatatttaatatt
actcttttagaaatattaggaatatgtgaagataaattaaaaataaaaaaaatagaattt
gaatag

DBGET integrated database retrieval system