KEGG   Bacillus cereus Q1: BCQ_0052Help
Entry
BCQ_0052          CDS       T00852                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-c-methyl-d-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bcq  Bacillus cereus Q1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCQ_0052 (ipk)
Enzymes [BR:bcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BCQ_0052 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
47883..48761
Genome map
AA seq 292 aa AA seqDB search
MNRLKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELMELAEDRIEILSHN
RYVPDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLW
NLGLTIDQLAELGAEIGSDVSFCVYGGTAIATGRGEQIEHIKTPPSCWVILAKPHIGVST
ADVYGNLKLNRVTHPNVDKMVDVINAGDYKGICDTVGNVLEDVTFAMHPEVARIKAQMKR
FGADAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagattgaagctactagtgaaagcaccagcaaagattaatctgtcgttagatgta
ctgggaaaaagacaagacggatatcatgaagtgaaaatgattatgacaacaattgattta
gcggatcgtttagaactaatggaattagcagaagaccgtattgaaattttatcccataat
cggtatgtcccagacgaccaaagaaatctggcttatcaagcagcgaaattattaaaagag
aagtttaatgtgaaaaaaggtgtatctattactattgaaaaaacgattccagtagcagct
ggattagcgggtggaagtagtgatgcagcagcgacattacgtggtcttaataaattatgg
aatttagggcttacaattgatcagttagcagagcttggcgcagaaattgggtcagacgta
tcgttttgcgtatatggtgggacagcaattgccactggaagaggggagcagattgagcac
ataaaaactccaccttcttgttgggttattttagcaaaaccccatattggtgtatctact
gctgatgtgtatggaaatttaaagttaaatcgagttacacatccaaatgtagataaaatg
gtggatgttataaatgctggagactacaaagggatttgtgatactgtcggtaacgtttta
gaagatgtaacgtttgcgatgcatcctgaagttgcacgtattaaggcacagatgaagcga
tttggagcagatgccgtattaatgagtggtagtggtccaactgtattcggtctggtgcac
catgattcgcgaatgcatcgtatatataacggattaaaaggattttgtgaacaagtatac
gcagtacgtttattaggagagcgagaaacgcttgaataa

DBGET integrated database retrieval system