KEGG   Bacillus cereus Q1: BCQ_0081Help
Entry
BCQ_0081          CDS       T00852                                 

Gene name
sul
Definition
dihydropteroate synthase (dhps) (dihydropteroate pyrophosphorylase)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bcq  Bacillus cereus Q1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCQ_0081 (sul)
Enzymes [BR:bcq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BCQ_0081 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77285..78127
Genome map
AA seq 280 aa AA seqDB search
MCSLKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGA
HIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAH
IINDVWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMVADLYDSIKIAKDAGVR
DENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEG
TGATVCLGIEKGCEFVRVHDVKEMARMAKMMDAMIGKGVK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagtttgaagtgggattatgatttgcgctgcggcgaatatacattgaacttaaat
gaaaaaacgttaattatggggattttaaatgtaacaccagattcgttttctgatggtggg
agttacaacgaggtagatgctgcagtgcgccatgcgaaagaaatgcgagatgaaggtgct
catattattgatattggtggcgaatctactcgtccgggctttgctaaagtgtcagtggaa
gaagaaataaaacgagttgttccaatgattcaggctgtttcaaaagaggtgaaattgcct
atttctatcgacacatataaagcggaagttgcaaaacaagcaatcgaagctggtgctcat
attattaatgatgtttggggagcgaaggcggaaccgaaaatcgctgaagttgcggctcat
tacgatgtacctattatcttaatgcataatcgcgataacatgaattatcgtaatttaatg
gctgatatggttgctgatttatatgacagtattaaaattgctaaagatgctggtgtacga
gatgagaatatcattttagacccgggcatcggttttgctaaaacacctgaacaaaattta
gaagcgatgcgtaatttagaacagttaaacgtactaggttatccagttctcttaggtact
tcaagaaagtcctttattgggcatgtgctagatttgccggtagaagaacgtcttgagggg
acgggagctaccgtttgtcttggtattgaaaagggttgtgagtttgttcgtgttcatgat
gtgaaggaaatggcacgtatggctaagatgatggatgcgatgatcggtaagggggtaaag
taa

DBGET integrated database retrieval system