KEGG   Bacillus cereus Q1: BCQ_0179Help
Entry
BCQ_0179          CDS       T00852                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00220  Arginine biosynthesis
bcq00330  Arginine and proline metabolism
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01130  Biosynthesis of antibiotics
bcq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BCQ_0179 (rocF)
   00330 Arginine and proline metabolism
    BCQ_0179 (rocF)
Enzymes [BR:bcq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BCQ_0179 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACM10682
UniProt: B9J0E8
Position
152430..153323
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEVDV
NTSLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHPTLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIVTSAEFVEVNTILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatctcagttattggagttccaatggatttaggacagatgcgtcgtgga
gttgatatgggaccgagcgcaatccgttatgcaggtgtaattgaaagaattgaagaaatt
ggatatgatgttaaagatatgggagatatatgtatagagagagaaaaagaagtagatgta
aatacaagcttaagaaaccttacacaagttgcaactgtatgtaacgaattagcaagtaag
gtggatcatattatagaagaaggacgttttccacttgtattaggtggagatcatagtatc
gctattggtacattagctggtgttgcgaaacattataaaaacctaggtgttatttggtat
gacgcacatggcgatttaaatacagaagaaacttcaccatctggaaatattcatggtatg
tcacttgcagcaagtttagggtatggacatccgacgcttgtagatttatacggggcatat
ccaaaggtgaaaaaagagaatgttgtaattatcggtgcacgtgcattagatgaaggagaa
aaagactttattcgaaatgaaggtattaaagtattttcaatgcacgagattgatcgtatg
ggtatgacggctgttatggaagaaacaatcgcgtatttatctcatactgatggtgtgcat
ttatcattagacttagatggtcttgatcctcatgatgcaccaggagttggaacacctgta
attggtggcttatcttatcgtgaaagccatttagcaatggagatgttagcggaagctgat
attgttacatctgccgagtttgttgaggtaaatacgattttagatgagcgaaatagaacg
gcaacaacagcggttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system