KEGG   Bacillus cereus Q1: BCQ_0394Help
Entry
BCQ_0394          CDS       T00852                                 

Gene name
argE
Definition
acetylornithine deacetylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bcq  Bacillus cereus Q1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bcq01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bcq00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
379358..380506
Genome map
AA seq 382 aa AA seqDB search
MVIDILKDIVKINTANPGGNTKDLINYIIKKINKYDFEYEIFKTSESKVNLIIKVRGKVN
KTVVLNGHLDTKPYGNMNEWKYDPYAATEENKRIYGLGACDMKAGVASMITLLCTIGEEK
LIPRWNLEFHFVDDEENNSTYGMKSLLNSNILQRDLYDLAVVCEPTENSLVLESLGNSWK
IIKVKGKKAHAGHYEEGVNANEVLANVLIKAQKKISKMKGENPSFPMFPNINIGIFKGGD
HPGSVTDYSEAVIDIRVSKEFEKKMILEEIENVLEEYDVHYQINDYLPEMYSWDYKNLST
EFSSECLNILMDKFKDTFKQVIAKNKFYGGSDAGYYAEKLGVPTIIFGPGSLQQAHQPNE
WVNIKGVMDHFKILQKWMIDID
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggtaatagatattctaaaggatatagtgaaaattaatacagctaatcccggtgggaat
acaaaagacttaataaattatattataaaaaaaataaataagtatgattttgaatatgaa
atatttaagaccagtgagtcaaaagtcaatttaattataaaagtaagaggtaaagttaat
aaaacagttgtgttgaatggtcatcttgatacaaagccttacggaaatatgaatgaatgg
aagtacgatccatatgctgctactgaagagaacaagcgtatctatggtttaggtgcatgt
gatatgaaggcaggagtagcttctatgattactcttttatgtacaataggggaagaaaaa
ttaattccaaggtggaatttagaatttcattttgtagatgatgaggaaaataatagtaca
tatggaatgaagagtttgttaaattcgaatattttacagagagatttgtatgatttagca
gttgtgtgtgaacctactgaaaatagtctagtattagaatctttggggaattcttggaag
ataattaaagtaaaggggaagaaagcccatgctggccattatgaagaaggggtaaacgct
aacgaagtattggcaaatgtattaataaaggctcagaagaaaatcagcaaaatgaaagga
gaaaatccatcttttccaatgttccctaatattaatataggaattttcaaaggtggagat
catccaggatctgtaacggattattctgaagctgttatagacattagggtaagtaaagag
tttgaaaaaaagatgatattggaagaaatagaaaatgttcttgaagagtatgatgtgcat
tatcaaatcaatgattaccttccagagatgtattcatgggattataaaaatttatcaact
gaattttcaagtgagtgtttaaacatattaatggataaatttaaagatacttttaagcaa
gttatagcaaaaaataaattttatggtggctccgatgctggctattatgccgaaaaatta
ggggttcctactattatttttggtccaggtagtttacaacaggctcatcaaccaaatgaa
tgggtcaatattaaaggtgttatggatcattttaagattttacagaaatggatgattgat
attgattga

DBGET integrated database retrieval system