KEGG   Bacillus cereus Q1: BCQ_1191Help
Entry
BCQ_1191          CDS       T00852                                 

Gene name
aceB
Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bcq  Bacillus cereus Q1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCQ_1191 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCQ_1191 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BCQ_1191 (aceB)
Enzymes [BR:bcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BCQ_1191 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1179689..1181278
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLPGEMLPAYNEILTPEALSFLKELHGNFNERRIELLQKRAEKQKRIDAGEF
PKFLEETKHIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAIEGQINLRDAVKGTISHKNENGKEYHLNSKTAVLIVRPRGWHLEEKHMQVDGKN
MSGSLVDFGLYFFHNAKALLAKGSGPYFYLPKMESHLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKGFRNHNQFLLPDRAQVTM
TAPFMRAYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEIHVTEKDLLEVPVGTITEEGLRLNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELK
EEELAKIEREIGKEAFKEGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacattgcccggagaaatgttgccagcgtacaacgaa
atattgacacctgaggcgcttagttttttgaaggaactacatggaaatttcaatgagcgc
cgcatagaacttttacaaaagcgtgcggagaaacaaaagagaattgatgcaggggagttt
ccgaagtttttagaagaaacgaagcacatacgtgaagctgattggacaattgctaaattg
ccaaaagatttagaggatcgccgcgtagagattactggcccggtagatagaaagatggtt
attaacgctttaaattcaggagcacatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcgattgaaggtcaaataaacttacgagatgcagtaaagggaacg
atttcacataaaaatgaaaacggaaaagaatatcatttaaatagtaaaacagcagtatta
attgtgcgtccaagaggatggcatttagaagaaaaacatatgcaagttgacggaaagaat
atgtctggtagcttagtagattttggactttattttttccataatgcgaaagctctttta
gcaaaaggaagcggtccatacttttacttaccgaaaatggaaagccatttagaagcaagg
ttatggaatgatgttttcgtatttgctcaaaaatatatcggtattccaaacggaacgatc
aaagccacggtgttactggaaacgatacatgcttcgtttgaaatggatgaaattttgtat
gagcttaaagatcattctgctggattaaattgcggaagatgggattatatttttagtttt
ctaaagggtttccgtaatcataatcaatttttacttccagatagagcgcaagtcacgatg
acggcgccatttatgcgcgcgtattctttgaaagtcattcaaacatgtcaccgtcgtaat
gcaccagctattggaggaatggcagcacaaattccaattaaaaacaatccagaagcaaat
gaagcagcttttgaaaaagttcgtgcggataaggagcgcgaagctttagacggtcatgac
gggacttgggttgcccacccgggacttgtaccagtcgcgatggaagtatttaatcacatt
atgaaaacgccgaatcaaatttttagaaaacgtgaagaaatacatgttacagaaaaggat
ttattagaagtaccagtgggaacgattacagaagagggtcttcgtctgaatattagcgta
ggtattcaatatattgcatcttggttaagcggccgaggagcagcaccaatttataactta
atggaagatgcagcaacagcggaaatttctagggcacaagtatggcaatggattcgccat
gaaggtggaaaattaaatgatggccgtaatattacacttgaattaatggaagagctaaaa
gaagaagagttagcaaaaatagaaagagagattggtaaagaagcctttaaggaagggaga
ttccaagaggcgacaacgttgtttacaaatctcgttcggaatgatgaattcgtaccattt
ttaacattaccgggttatgaaattttataa

DBGET integrated database retrieval system