KEGG   Bacillus cereus Q1: BCQ_1192Help
Entry
BCQ_1192          CDS       T00852                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00630  Glyoxylate and dicarboxylate metabolism
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01120  Microbial metabolism in diverse environments
bcq01200  Carbon metabolism
Module
bcq_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BCQ_1192 (aceA)
Enzymes [BR:bcq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BCQ_1192 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACM11622
UniProt: B9ITE0
Position
1181302..1182579
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQESWELDTRWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWASLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGGGDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTKAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIHKEH
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaaattacaagagagctgggaactagatacgcgttggaaa
gggatcacacgtccatattcggcagaagatgtaattcgcttgcgcggatcgattgatatt
gaacatacgttagctcgccgcggtgctgaaaagctttgggcgtcgcttcatacagaagat
tacattaacgcacttggtgcattaacaggaaaccaagcgatgcagcaagtaaaagctggt
ttaaaagcaatttacttaagtggttggcaagtagcagcagatgcaaacctttctggacat
atgtatccagaccaaagtttatatccagcaaatagcgtacctgctgtagtaaaacgaatt
aatcaaacgcttcaacgtgcggatcaaattcagcatatggaaggaggcggtgatacagat
tatttcgtaccaattgtagcagatgcagaagctggatttggcggacaattaaacgtattt
gaactgatgaaaggtatgattgaagcgggtgcatcaggtgtgcactttgaagatcaatta
tcttcagagaaaaaatgcggtcatttgggcggaaaagtattactaccgacgcaaacagcg
gtgcgtaatttaatttcggcacgccttgcggcagacgtaatgggagtaccgacaattatc
gttgcaagaacagatgcggatgcagcagatttaattacgagcgatatcgatcctgttgat
aaagcgtttattacaggagaaagaacaccagaaggattttaccgtacgaaagcaggtctt
gaccaagcgattgcacgtggtttagcatacgctccttacgcagacctcgtttggtgtgaa
acatctgaaccaaatttagaagatgcaaaacgatttgcggacgcaattcataaagagcat
ccagggaaattgcttgcatacaattgttccccttcatttaactggaaacaaaaactagat
gagaaaacaattgcgagcttccaaaaagaaatcgcatcttacggttataagttccagttc
gtaacacttgctggattccactcattaaactacggcatgttcgaattagcacgcggctat
aaagagcgcggcatggcagcttactctgaactacaacaagcagaattcgcagcagaaaaa
cacggctactctgcaactcgccatcaacgagaagtaggaacaggttactttgatgaagta
gcacaggtgattacaggtggtacttcatcaacgacagcattaaaaggatctacagaagaa
gcacagtttacgaaataa

DBGET integrated database retrieval system