KEGG   Bacillus cereus Q1: BCQ_1281Help
Entry
BCQ_1281          CDS       T00852                                 

Gene name
rfbC
Definition
dtdp-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bcq  Bacillus cereus Q1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:bcq00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bcq00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1273549..1274094
Genome map
AA seq 181 aa AA seqDB search
MEVIETNFTDAKLLEPRLFGDERGFFTESYNKKVLETLGVTYSFVQDNVSYSTEAGTIRG
LHFQKNPKAQTKLIQVMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHG
FCTLVPHTIVMYKVDEYYSANHDSGVLWNDKDLAIPWPVTSPILSDKDRILPSLQECEDS
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggaagttatagaaacaaactttaccgacgcaaaattgttagaaccgaggttatttgga
gatgagcgtggcttttttactgaaagttataataagaaggtgctagaaacattaggagtt
acgtattcatttgtacaggataatgtttcgtattcgacagaagcgggaacgattcggggg
ttacactttcaaaaaaatccgaaagcacaaacgaaacttattcaagttatgcaaggagca
atttatgacgttatcgttgatttgcgaaaagattcaccaacgtttaaacaatggagagga
tatattttaagcgcggataatcatcggcaattattagtgccaaaaggatttgcacatggt
ttttgtacacttgtcccgcatactattgttatgtataaagtagatgagtattatagtgct
aatcatgactcaggggtactttggaatgataaagacttagcaattccatggccggtaaca
agccctattttgtctgataaagatcgaatattaccatcgcttcaggaatgtgaagatagt
ttttga

DBGET integrated database retrieval system