KEGG   Bacillus cereus Q1: BCQ_1305Help
Entry
BCQ_1305          CDS       T00852                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bcq  Bacillus cereus Q1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCQ_1305 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCQ_1305 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCQ_1305 (trpA)
Enzymes [BR:bcq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCQ_1305 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1294496..1295257
Genome map
AA seq 253 aa AA seqDB search
MKAAFENGKKAFIPYVMGGDGGLEKLKERIRFLDEAGASIVEIGIPFSDPVADGPTIQRA
GKRALDGGVTLKGIFQALAEVRKEVQIPFVLMTYLNPVLAFGKEHFIERCLEAGVDGIIV
PDLPYEEQDIIAPLLRTANIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVTGVRQN
FKEEIHSYLEKVKSHTHLPVVAGFGISTKEHVEEMITICDGVVVGSKIIELLENEKREEI
CEFIQATKQKEEA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcatttgaaaatggcaagaaagcatttattccgtacgtaatgggcggagat
ggtggccttgaaaaattaaaagaaagaattcgttttcttgatgaagcaggagcaagcatc
gttgaaattggtatcccgttttcagatccagtcgcagatggcccaacgattcaaagagca
gggaaacgagcgctagatggcggtgtaacattaaagggcatttttcaagcgttagcagaa
gtaagaaaagaagtacaaattccttttgtactcatgacatacttaaatccagtacttgca
ttcggaaaagaacacttcattgagagatgcttagaagcaggtgtggacggtattatcgtt
ccagacttaccgtatgaagaacaagatattattgcaccgcttctccgaactgcaaatatc
gctttaatcccactcgttaccgttacgagcccaattgagcgaatcgagaaaattacgagt
gaatcagaagggttcgtctacgctgttacagtagcaggcgtaacaggcgtacgtcaaaac
tttaaagaggagattcatagttacttagaaaaagtaaaatcacatacgcatttaccggta
gtggcagggttcggtatttcaacaaaggaacatgtagaagaaatgattacaatatgtgac
ggggttgtcgttggaagtaaaattattgaactgttagaaaatgaaaaacgagaagaaata
tgtgaattcatacaggcaacaaaacaaaaagaagaggcataa

DBGET integrated database retrieval system