KEGG   Bacillus cereus Q1: BCQ_1764Help
Entry
BCQ_1764          CDS       T00852                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcq  Bacillus cereus Q1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCQ_1764 (gpm)
   01230 Biosynthesis of amino acids
    BCQ_1764 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCQ_1764 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BCQ_1764 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCQ_1764 (gpm)
Enzymes [BR:bcq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCQ_1764 (gpm)
Exosome [BR:bcq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCQ_1764 (gpm)
  Exosomal proteins of melanoma cells
   BCQ_1764 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1731928..1732497
Genome map
AA seq 189 aa AA seqDB search
MTTIYFVRHAHSTYTKEERERPLSEKGHLDAENVTRLLKDKHIDVVISSPYKRAIQTVQG
IANTYHVSIEIEENLRERLLSKEPVTDFNDAVQKVWEDWDFAYEAGESNEVAQRRAVICM
QNILKKYEDQNIVIGTHGNIMVLLMNYFDSKYDFRFWKTLRMPDIFKLNFHNEDLISAER
IENTGHQIK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaatatatttcgttcgccatgcccattctacatatacaaaagaagaacgggag
cgacctttatctgaaaaagggcacttagatgcagagaatgtaacacgcttattaaaagat
aaacatattgatgttgtgatttctagcccctacaaaagagcaattcaaactgtacaagga
attgcgaatacatatcatgtatcaatagaaatagaagaaaatttacgggaaagattatta
agtaaagagccagtaacagattttaatgatgcggtccaaaaggtgtgggaagattgggat
tttgcatacgaggccggagaatcgaatgaagtagcgcaaaggcgtgctgtaatatgtatg
caaaatatattaaaaaaatatgaagatcagaatattgtaataggaactcatggaaatatt
atggtattactcatgaattattttgattcaaaatatgattttcgattttggaaaacactt
cgtatgcccgatatatttaagttgaattttcataatgaagatttaatttctgccgaaagg
atagagaatacgggtcatcaaataaagtga

DBGET integrated database retrieval system