KEGG   Bacillus cereus Q1: BCQ_1770Help
Entry
BCQ_1770          CDS       T00852                                 

Gene name
asnO
Definition
(GenBank) asparagine synthetase, glutamine-hydrolyzing
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00250  Alanine, aspartate and glutamate metabolism
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCQ_1770 (asnO)
Enzymes [BR:bcq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BCQ_1770 (asnO)
Peptidases [BR:bcq01002]
 Cysteine Peptidases
  Family C44
   BCQ_1770 (asnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700
Motif
Other DBs
NCBI-ProteinID: ACM12198
UniProt: B9IWK5
Position
complement(1735748..1737571)
Genome map
AA seq 607 aa AA seqDB search
MCGITGWVNWNKDLSNEHVILKKMANRIQHRGPDAEGFWFSPRAAFAHRRLIVIDPEGGT
QPKTFRAGDYTYALTYNGEIYNFRELREQLRKCGHTFETHSDTEVLLHAYLEWKEDCVQH
LNGIFAFALWDDQKQQLFLARDHLGVKPLFYTERNDSIIFGSEIKALLAHPSVPAEIDTD
GINEIFGLGLFRTPGCGVFKHIQEVRAGHSITFTRDKKVVTKYWNLESKVHTDSIEDTSS
HILSILQDTVKRQLIADVPLVCMLSGGLDSSGITALAGKEFAAENKTLHTYSVDFVNSAK
DFELTFARTGLDAPWVKRVSEHVGTSHHDIIVNAEELANHLFVPLRAKDLPSAGEMETSL
YLLFCEMKKDATVALSGESADEVFGGYPWFHQEELLYVDKFPWLTNWKNTSPLLLHEISN
QCNLENYIDTRFQEAILEVPTLEGESKKSAKQRQMFYLFLTRFLPFLLDRKDRMSMAVGF
EVRVPFCDYRLVEYLWNVPFNIKSIDNIEKGILRRALKPALPDDVRNRRKSAYPTSQDPH
YLQTIRNLTLEMCSNKNNPIFSLINHSTLLAIADQSNKEINNFEARSAMEYMLQVNEWLK
TYHIHIA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattacaggttgggtaaattggaataaagatctttccaatgaacatgttatt
ttaaaaaagatggcaaatcgtattcagcatcgcggtccggatgctgaaggattttggttt
tcacctcgcgcggcttttgcacaccgccgtttaattgtaattgatccagaaggtgggaca
cagccgaagacatttcgtgctggtgattatacgtatgctcttacttataatggagaaatt
tataatttccgtgagctgagagaacaacttaggaaatgtggtcatacatttgaaacgcat
tcagatacagaagtgttactacatgcttatttagaatggaaagaagactgcgtacaacat
ttaaacggcattttcgctttcgccttatgggatgatcagaagcaacaactgtttttagca
cgtgatcatttaggcgtaaaaccactcttttatacagaaagaaatgacagtattattttc
ggatctgaaattaaagcattattagctcatccatctgtccctgctgaaattgatacggat
ggcataaatgaaatatttggattagggttatttcgaactccaggatgtggcgtctttaaa
catattcaagaagtgcgtgctggacattctataacgtttacacgtgataaaaaagtagtt
acgaagtattggaatttagaaagtaaggtccatacagattctatagaagatacatcatca
catattttatctattttacaagatacagtaaaaagacaattaattgccgatgtccctctc
gtctgcatgttatcaggaggattagattctagcggtattactgcactagcaggaaaagaa
tttgctgctgaaaataaaacacttcatacgtattccgttgactttgtaaatagcgcaaaa
gatttcgagctgacatttgctcgcactggtttagacgctccttgggtaaaacgcgtttct
gaacatgtagggacatctcatcatgatattattgtgaatgctgaagaattagctaatcac
ttattcgttcccctccgtgcaaaagatttaccgagtgctggcgaaatggaaacttcacta
tatttactattttgcgaaatgaaaaaagatgcgaccgtagctttatcgggagaatctgct
gatgaagtattcggtggatatccttggtttcatcaagaagaattactatatgtagataaa
tttccttggctaacaaattggaaaaatacatctcctcttctactacatgaaataagtaac
caatgtaatctagaaaactatattgatacacgattccaagaagcgatacttgaagtacct
actcttgaaggtgaaagtaaaaaatccgcgaaacaacgtcaaatgttttatttattttta
acgagatttcttccgttcttacttgaccgtaaagaccgtatgagtatggctgtaggattt
gaagttcgtgtaccgttttgcgattatagattagttgaatatttatggaacgttcctttc
aacataaaaagcattgataatattgaaaaaggcattttacgtagagcactgaaacctgct
ttacctgacgatgtacgtaatagaagaaaaagtgcttatccaacttcacaagacccacat
tatttacaaacaatccggaatttaacacttgaaatgtgtagtaataaaaacaaccctatt
ttctcacttattaatcattccacattacttgctattgccgatcagagtaataaagaaatt
aacaatttcgaagcaagaagtgctatggaatacatgctacaagtaaatgaatggttaaaa
acgtatcacatccatattgcttaa

DBGET integrated database retrieval system