KEGG   Bacillus cereus Q1: BCQ_1855Help
Entry
BCQ_1855          CDS       T00852                                 

Gene name
ilvA
Definition
threonine dehydratase
Orthology
K01754  
threonine dehydratase [EC:4.3.1.19]
Organism
bcq  Bacillus cereus Q1
Pathway
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Class
Metabolism; Overview; Carbon metabolism [PATH:bcq01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bcq01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bcq00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:bcq00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1830978..1832180
Genome map
AA seq 400 aa AA seqDB search
MKDIVIKTPLQRDTVLSEKYDCDVYVKREDLQLIRSFKIRGAYNLIQSLPKVQLQNGVVC
ASAGNHAQGVAYTCNLLKIPSKIFMPTTTPKQKVSQVQFFGGDFAEIVLVGDTFDSSFQE
AQRYCEENRMTFVHPFDDPYVVAGQGTVAVEIMHDMEKPVDYIFTAIGGGGLASGVGTYV
KGVSPATQVIGVEPMGAASMKEAFLQNDNVALEKIDSFVDGAAVKKVGKLTFETCKDVID
DIVLVPEGKVCTTILELYKKNAIVAEPAGALSIAALDLYRDEIKGKTVVCTLSGGNNDID
RMQEMKERSLIYEGLKHYFIIEFPQRSGALREFLDKGLGPEDDITRFEYIKKHNKENGPA
LVGVELKHKEDYEQLITRFKENNIQFMELNKNPVLFDLLI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatatcgttattaaaacaccgttacaacgtgatacagttttatctgagaaatat
gattgtgacgtttatgtaaaacgagaagacttacaattaattcgctctttcaaaattcgt
ggtgcgtataatctaattcaaagtttaccgaaagtacaattacaaaacggtgttgtttgt
gcaagtgctggtaatcatgcgcaaggagtagcttatacgtgtaatttattgaagattccg
tcaaaaattttcatgccgacgacgacacctaaacaaaaagtgtcacaagtacaatttttc
ggtggtgattttgcggaaattgtattagttggtgatacatttgatagctctttccaagaa
gcacagcgttattgtgaagaaaatagaatgacatttgttcatccgtttgatgatccgtac
gtagttgctggtcaagggacagtggcagttgaaattatgcatgatatggagaaaccggtt
gattatatctttacagcaattggtggtggtggattagcatcaggtgttggtacatatgtg
aaaggtgttagtcctgctacacaggtcattggggtagagccaatgggagctgcatctatg
aaagaggcttttcttcaaaatgataatgtcgcattggagaaaatagatagttttgttgat
ggggcagcggttaaaaaggtaggaaagttaacatttgaaacttgtaaagatgtaattgat
gacattgttttagtaccagaaggaaaggtttgtacgacgattttagaactgtataagaaa
aatgcgattgtagctgaaccagctggtgcactctctattgcagcgcttgatttatacaga
gatgaaataaaaggtaaaacagttgtttgtacgctaagtggtggaaataatgatattgat
agaatgcaagaaatgaaagaacgatctctcatttatgaaggattaaagcattatttcatc
attgaattcccacagcgttcaggtgcgttaagagaatttcttgataaaggattagggcca
gaagatgatattactcgctttgagtatattaagaaacataataaagaaaatggtccagca
ttagtcggagtagagttaaaacataaagaagattatgagcaattaattactcgttttaaa
gaaaataatattcaatttatggagcttaataaaaatcctgttttgtttgatttgcttatt
taa

DBGET integrated database retrieval system