KEGG   Bacillus cereus Q1: BCQ_1958Help
Entry
BCQ_1958          CDS       T00852                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bcq  Bacillus cereus Q1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCQ_1958 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCQ_1958 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BCQ_1958 (thrC)
Enzymes [BR:bcq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BCQ_1958 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1938045..1939103
Genome map
AA seq 352 aa AA seqDB search
MYKGLLNEYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEDGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQSAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI
GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISANTLDIASVSNNIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggactattaaacgaatatgcttcttatttaccggtaaatgaaaacacacct
gatgtgagcttaatggaaggaaatacaccccttattccgttattaaatatatcaaaacaa
ttagggattcagttatatggtaagtacgaaggagcgaatccgacaggttcctttaaagat
cgtggtatggtaatggcagtcgcaaaggcgaaagaagacggttcggaggccattatttgc
gcatcgacaggcaatacatcagcatcggctgccgcatacgcggcacgccttggaatgaaa
tgtattatcgtaataccggaaggaaagattgcacatggaaaattagcgcaagcagttgcc
tatggtgctgaaatcatttcaatagaaggaaattttgatgatgcactaaaggctgtaaga
aatattgctgcagaagagccaatcacattagttaactcggtaaatccttatcgaattgaa
gggcaaaaaacagcagcatttgaaatttgtgaccaattgcaaagtgcaccagatgtttta
gcgattcctgttgggaatgctgggaatattacagcgtactggaagggtttctgtgaatat
gagaaagaaaaaggatataagaagccaagaattcatggatttgaagcggaaggagcagct
gctattgtaaaagggcatgtaattgacgagccagaaacaattgcaacagcgattcgcatc
ggtaacccagcaagttggtcatatgcagtagaggctgctgagcaatctcacggtgaaata
gatatggtatcagatgaagaaattttacatgcgtatagattattagcaaaatcggaaggg
gttttcgctgagccaggatcaaatgcttcattagctggcgtaatgaaacatgttcaatct
ggaaaaatcaaaaaaggagaaacagttgttgcagttttaactggaaacggcttgaaagat
cctgatatcgcaatctctgctaatacattagatattgcaagtgtttcaaataatatagaa
caaattaaagagcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system