KEGG   Bacillus cereus Q1: BCQ_1991Help
Entry
BCQ_1991          CDS       T00852                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bcq  Bacillus cereus Q1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCQ_1991
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCQ_1991
   00052 Galactose metabolism
    BCQ_1991
   00500 Starch and sucrose metabolism
    BCQ_1991
   00520 Amino sugar and nucleotide sugar metabolism
    BCQ_1991
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCQ_1991
   00524 Butirosin and neomycin biosynthesis
    BCQ_1991
Enzymes [BR:bcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BCQ_1991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1970290..1971186
Genome map
AA seq 298 aa AA seqDB search
MKKAVGIDIGGTKIAAGVVSDTGELLERTEVKSDPLDREKMFGRVVEAVEQVLRKLSVSI
SDIEGIGVGVPGKVDCENGIAVFQNNLPWSQFPISVRLQEQFGIQRITIDNDVYMAAFAE
WKAAHVKGNETFVYVTISTGISCSIIHKGSFFRGAGFAGELGLIPVLSKGINERLEKIAA
GPGIQRIAERDLQVGTISTKDVFASYINGVPEYQSIINEVTDYLAQGLYKISCLLDPHRM
VFGGSVIVKNPFLLELIKVKLKSFQLPEQQHLLEQMSISTLAQNNGVVGAGLRVFEGM
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggcagtcggtattgatattggaggaacgaagattgcagcgggagttgtttca
gatacaggcgaactgctcgaacgtacggaagtaaaaagtgatcctttagaccgggaaaaa
atgtttggtagagttgtagaagctgtggaacaagttctcagaaaattatcagtttccatc
tctgatattgagggtattggcgttggagtaccgggaaaagtggattgtgagaatggaatt
gccgtttttcaaaacaatttaccgtggagccagtttcctatttcagtccgtttgcaggag
caatttggaatccagcggattacgattgacaatgatgtctatatggcggcttttgccgaa
tggaaagcagcacatgtaaaaggaaatgaaacctttgtctacgtgactataagtacggga
atatcttgttctatcattcataaaggctcattttttaggggagcaggatttgctggagaa
ctaggtttgatccctgttctatcgaaggggatcaatgaacgattagaaaaaatcgctgct
gggccagggatccagagaatagccgaaagagatttacaggtaggtacgatttcaacaaaa
gatgtttttgctagttatataaatggggtaccagaatatcagtccattatcaatgaggta
actgattatttagctcaaggtctttataagatttcctgtttattagatccacatagaatg
gtttttggtggcagtgtcattgtgaaaaatccatttctactggagttgatcaaagtgaag
ctaaagagttttcagcttcctgagcaacaacatcttttggagcagatgagcatcagtaca
ttggcacaaaataatggagttgttggtgcgggattacgagtatttgaaggtatgtaa

DBGET integrated database retrieval system