KEGG   Bacillus cereus Q1: BCQ_2096Help
Entry
BCQ_2096          CDS       T00852                                 

Gene name
bsaA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bcq  Bacillus cereus Q1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bcq00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bcq00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2064609..2065091
Genome map
AA seq 160 aa AA seqDB search
MTIYDFSAKTITGEEKSLKDYEGKALLIVNVASKCGFTPQYKGLQEVYDKYKEQGLEILG
FPCNQFGGQEPGTEADITSFCELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGMK
AVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttatgatttttcagctaaaacaattacaggtgaagaaaaatcgttaaaagat
tacgaaggaaaagcacttcttattgtaaatgtagctagtaaatgcgggtttacaccgcaa
tataaaggattacaagaagtatatgataaatataaagaacaagggctagaaatactcggt
ttcccatgtaaccaattcggaggacaagaaccaggtacagaagcagatattacaagtttt
tgtgaattaaactacggcgtaaacttcccaatgtttgcaaagattgatgtaaaaggtgat
aaggctcatcctctgtatacatacatgacagaacaagcaccaggtttactcggtatgaaa
gcagtgaaatggaactttactaagtttttaattggaaaagacgggaaagtagtagggcgt
tttgctccgcagacgaagccggtggatttagaggttgagattgagaaggtacttggcgaa
taa

DBGET integrated database retrieval system