KEGG   Bacillus cereus Q1: BCQ_2188Help
Entry
BCQ_2188          CDS       T00852                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bcq  Bacillus cereus Q1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bcq00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2162235..2164136
Genome map
AA seq 633 aa AA seqDB search
MCGFVGCLCENPREFSETEKHQFENMNTMIFHRGPDDEGYFRDEHVQFGFRRLSIIDLEA
GHQPLTYENDRYVIIFNGEIYNYVELREMLLEKGATFATQSDTEVIIALYAHMKEKCVDY
LRGMFAFMIWDREEKKLFGARDHFGIKPLYIAQQGDTTFFASEKKSIMHVMEDKGVNPTS
LQHYFTYQYGPEPETLTIDVNKIEPGHYFVKEIGKEMEIHRYWKPYFNASSATKEEHIQA
IRDVLYDSVKVHMRSDVPVGSFLSGGIDSSIIASIAREMNPNLLTFSVGFEQRGFSEVDV
AKETAEKLGVKNHNVFISAKEFMDEFPKIIWHMDDPLADPAAVPLYFVAKEARKHVTVVL
SGEGADELFGGYNIYREPNSLKMFSYIPSPGKSVLKALSGALKEGFKGKSFLERGCTPIE
ERYYGNAKIFREEEKAELMKYYNESVNYMDITKPLYNEIKDYDDVSKMQYIDMFTWLRGD
ILLKADKMTMANSLKLRVPFLDKEVFDVASKIPTEFKIANGTTKAILREAARGIVPDHVL
NRKKLGFPVPIRHWLKDEMHDWAINIINESKTEHLIDKQYVLNLLEAHCADKGDYSRKIW
TVLAFMVWHQIYVEHKYDTNKFHEETKRAYSLV
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggttttgtaggatgtttatgtgaaaaccctagagagttttcagaaacagaaaaa
catcaatttgaaaatatgaacacgatgattttccaccgtggtccagatgacgaaggatat
tttcgtgatgaacatgtacaatttggcttccgccgtttaagtatcattgacttagaggca
ggacatcagccgctaacttatgaaaatgatcgatatgtaattatttttaatggtgaaatt
tacaactatgtagaattacgtgaaatgttacttgaaaaaggtgcaacgtttgcaacgcaa
tctgatacagaagttatcattgcattgtatgcacatatgaaagaaaaatgtgtagactac
cttcgtggtatgtttgcatttatgatttgggatcgtgaagagaagaaacttttcggtgca
cgtgatcacttcggtattaaacctttatacatcgcacaacaaggtgatactacattcttc
gcatctgagaagaaaagtattatgcatgtgatggaagataaaggtgttaatccaacgtct
ctacaacattactttacgtatcaatatggtccagagccagaaacattaacaattgatgtt
aataaaatcgagcctggtcattatttcgtgaaagaaattggtaaagagatggaaatccat
cgctactggaagccttatttcaatgcttcaagtgcaacgaaagaggaacatatccaagca
attcgtgatgtgttatatgattcagtaaaagtgcatatgcgcagtgatgtaccagtaggt
tcattcttatctggtggtatcgattcatctatcatcgcttctatcgcaagagaaatgaat
ccaaatcttttaacattctctgttggttttgagcaacgtggtttcagtgaagttgatgtt
gcgaaagaaactgctgagaaattgggcgttaaaaaccataatgtattcatttctgcaaaa
gagtttatggatgagtttccaaaaatcatttggcatatggatgatcctttagctgatcca
gcagctgtaccgttgtacttcgttgctaaagaagcacgtaaacatgtaacagttgttctt
tcaggtgaaggggcagacgagctatttggtggttataacatttaccgtgagccaaactca
ctgaaaatgttctcttacattcctagcccaggtaagagcgttctaaaagcattaagtggt
gctcttaaagaaggctttaaaggaaagagcttcctagagcgtggatgtacgccaattgaa
gagcgttactatggaaacgcgaaaatcttccgtgaagaagagaaagctgaattaatgaag
tattacaatgaaagtgttaactatatggatatcacgaaaccattgtataacgagattaaa
gattatgatgatgtaagtaaaatgcaatacattgacatgttcacttggttacgcggtgac
attttattaaaagctgataaaatgacaatggcgaactcattaaaacttcgtgtaccgttc
ttagataaagaagtattcgatgttgcatctaaaattccaactgaatttaaaattgctaac
ggaactacgaaagctattttacgtgaagcagcacgcggaatcgttccagatcacgtatta
aatcgtaaaaaacttggattcccagtaccaattcgtcactggttaaaagacgaaatgcat
gattgggctatcaatattataaacgagagtaagacagagcatttaatcgacaaacagtat
gtattaaacttactggaagcacattgtgcagataaaggcgattatagccgtaaaatttgg
actgtacttgcgtttatggtatggcatcaaatttatgttgagcataaatacgatacgaat
aagttccacgaagaaacgaaacgtgcgtatagcttagtttaa

DBGET integrated database retrieval system