KEGG   Bacillus cereus Q1: BCQ_2203Help
Entry
BCQ_2203          CDS       T00852                                 

Gene name
adhB
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bcq  Bacillus cereus Q1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCQ_2203 (adhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCQ_2203 (adhB)
  Lipid metabolism
   00071 Fatty acid degradation
    BCQ_2203 (adhB)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCQ_2203 (adhB)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCQ_2203 (adhB)
   00626 Naphthalene degradation
    BCQ_2203 (adhB)
Enzymes [BR:bcq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCQ_2203 (adhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2175417..2176454
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEIIEKELRPLHSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGIGIVTKIADDVTSLKVGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSNIKPGQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIVQDEFGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFIFG
AEGKVVPVVQTCSLDKVQSVFEEMEQGRIQGRMVIDFKQHNCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtagttaataaaaatagtaaagcaaatattgaaattattgaaaaggaa
ttacgtccgttacactcaggtgaagcgctagtagatgtagagtattgtggagtttgtcat
actgatttacacgttgcaaatcatgattttggaaacacagatggccgtattcttggtcat
gagggtataggtattgtgacgaaaatcgctgatgatgttacttcactaaaggtgggggac
cgtgtaagtattgcatggatgttccaatcttgtggacgttgtgaatattgcgtgactggt
agagaaacattttgccgtgaagttaagaatgctggttattcagtagatggtggtatggct
gaacaatgtattgtgacagctgattatgcggtgaaagtaccagaaggattagatccagct
caagcatcatcaatcacatgtgcgggtgtaactacatataaagctataaaagtatccaat
attaaacctggccaacctatcgtcatctatggttgtggtggattaggtaacctagctatt
caatatgctaaaaacgtatttggtgcaaaggtaattgcagtagatattaatgacgataaa
ttagccttagcaaaagaggttggagctgatatgacaatcaatccaatttctcaaggtcct
gctgataagattgttcaagatgagtttggtggtgcttatgctgctgtagtaacagctgtt
tcaaaagtagcattcaactctgcagttgatgcagtacgtgcttgtggtaaagtcgttgca
gtaggtttaccagtagaaacgatggatttaaacattccgcgacttgtactagatggaatt
gaagtggttggctctctagtcggtactcgtaaggatctagaagaggcatttatattcggt
gcagaaggaaaagtagtgcctgttgttcaaacttgttctctagataaagtacaaagtgta
ttcgaagaaatggaacaaggtcgaattcaaggacgtatggtaatcgattttaaacagcat
aattgtgattgcaaataa

DBGET integrated database retrieval system