KEGG   Bacillus cereus Q1: BCQ_2341Help
Entry
BCQ_2341          CDS       T00852                                 

Gene name
hemY
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00860  Porphyrin and chlorophyll metabolism
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCQ_2341 (hemY)
Enzymes [BR:bcq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BCQ_2341 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BCQ_2341 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 NAD_binding_9 DAO Pyr_redox_2 MNSV_P7B Prenylcys_lyase NuA4 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACM12769
UniProt: B9J0T7
Position
2307208..2308608
Genome map
AA seq 466 aa AA seqDB search
MKTVVVIGGGITGLSTMFYLEKLKKDYNIDLNLILVEKEEYLGGKIHSVEEKDFIMESGA
DSIVARNEHVMPLIKDLNLEEEMVYNETGISYIYSDNILHPIPSDTIFGIPMSARSLFSS
TLVSTKGKIVALKDFITKNKEFTKDTSLAVFLESFLGKELVERQIAPVLSGVYSGKLNEL
TMASTLPYLLDYKNKYGSIIKGFEENKKQFQSAGNKKFVSFKGGLSTIIDRLEEVLTETV
VKKGVVTTAVSKQGNRYEVSFANHESIQADYVVLATPHDIAETLLQSNELNEQFHTFKNS
SLISIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRKWKHTSGNQKLLVRMFYKS
TNPVYETIKNYNEEELVRVALYDIEKSLGIKGEPEVVEVTKWKDLMPKYHLEHNQAVQTL
QEKMTDLYPNVYLAGASYYGVGIGACIGNGKNTADEIIATLNEPTN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagttgttgtcatcggtggaggtataacgggactttctactatgttttattta
gaaaaattaaaaaaggattataatatagatttaaatttaatccttgtagaaaaagaagag
tacttaggtgggaaaatccatagtgtagaagaaaaggattttattatggaatccggagca
gattctatcgttgctcgtaatgaacatgtcatgccgcttataaaagatttaaatttagaa
gaagaaatggtatataatgaaacgggtatttcttacatatattctgataatattttacat
ccaattccttctgatactatatttgggataccgatgagtgcccgatcgttgtttagcagt
acgctagtatcaacgaaggggaaaattgttgctttaaaagatttcataacgaaaaataaa
gagtttacgaaggatacttctcttgctgtatttttagaaagctttttagggaaagagtta
gtagaaagacaaattgctccggtgctttcaggtgtatattctggtaaattgaatgagctt
actatggcgtctacactaccgtatttactggattataaaaataaatatggaagtattatt
aaaggttttgaagagaataaaaagcagtttcaatcagcaggaaataaaaagttcgtatca
tttaaaggtggattatctacgattattgatcgtttagaagaagtgctgactgagacggtt
gttaagaagggtgttgtaacgacagctgtaagtaaacaaggtaatcgctatgaagtctcc
tttgcaaatcacgaatcaatccaagctgattatgttgttttagcaactccgcatgatatc
gcagaaactttattacagtctaatgagttaaacgagcagtttcatacatttaaaaattca
tcacttataagtatttacttagggtttgacatactagatgaacaattaccagcggacggc
acaggatttatcgtaacagaaaacagtgatttacattgtgatgcttgtacatggacaagt
cggaagtggaaacatacatctggaaaccaaaagctattagtgagaatgttttataagagt
acgaatccggtatatgaaacgattaaaaattataatgaagaagaattagtacgagtcgct
ttatatgatattgaaaagagtctcggaattaaaggtgaaccagaagtagttgaagtgaca
aaatggaaagatttaatgccgaaatatcatttagaacataatcaagcagttcaaacatta
caagaaaaaatgacggatctatatcctaatgtatacttagcgggtgcctcatattacggt
gtcggaattggtgcgtgtattggaaatggaaagaacactgcagatgaaatcattgcaaca
ttaaatgaaccgacaaattaa

DBGET integrated database retrieval system