KEGG   Bacillus cereus Q1: BCQ_2464Help
Entry
BCQ_2464          CDS       T00852                                 

Gene name
adhB
Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00010  Glycolysis / Gluconeogenesis
bcq00071  Fatty acid degradation
bcq00350  Tyrosine metabolism
bcq00625  Chloroalkane and chloroalkene degradation
bcq00626  Naphthalene degradation
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01120  Microbial metabolism in diverse environments
bcq01130  Biosynthesis of antibiotics
bcq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCQ_2464 (adhB)
  Lipid metabolism
   00071 Fatty acid degradation
    BCQ_2464 (adhB)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCQ_2464 (adhB)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCQ_2464 (adhB)
   00626 Naphthalene degradation
    BCQ_2464 (adhB)
Enzymes [BR:bcq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCQ_2464 (adhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ACM12892
UniProt: B9J1V6
Position
2425768..2426694
Genome map
AA seq 308 aa AA seqDB search
MEQNKLVLEGPKRLKWETREIKSIQNDEIIVKTIAGAISIGAELPQYNGSDVTDTHPIYP
RKTGYESYGEVIQVGNKVKNLNIGDKVVSFYGHETIGVVNGYKVIRVPSYIKPKVALLSI
LSCDAAKGILKLNPRQDEKVLIAGMGVIGLLTCYFLKYYIGVEHVDIVEPDRNRREFAQK
FSVKNTFDAEEQIVETYNYGFECSATNSGFHTLQKTLKTNGQICILSDGNIEELTLTADF
YEKELRIIGSSDGYNYQQHADWFFSQIEKTPWIEEIFQHEIQHTGLIQCFEELSQGIITP
LKVFVSYE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaataaattagttttagaaggaccaaaacgtcttaagtgggaaacgcgcgaa
attaagtctatacagaatgatgaaattatcgttaaaacaattgcaggtgcaataagcatt
ggagcagagttacctcagtataatggatccgatgttacagatacacaccctatttatcca
agaaaaactggatatgaaagttacggtgaagtgattcaagttggtaataaagtaaagaat
ttaaacataggcgataaagtagtttctttttatggacatgaaacgataggagtagttaat
gggtataaagtaattcgagtacctagttatataaaacctaaagtagctttattatctatt
ctttcgtgtgatgctgctaaaggtatattgaaactaaacccgcgacaggatgaaaaggta
cttatagctggaatgggagttatcggtttacttacttgttatttcttaaaatactatata
ggtgttgagcatgtggatattgttgaacctgatagaaatagaagggaatttgcacagaaa
tttagtgtaaaaaacacatttgatgcagaagaacagatagtagaaacatataattatggt
ttcgaatgttctgctacaaatagtggattccatacattacaaaaaacacttaaaactaat
ggacaaatatgtatactttctgatggtaatattgaagaactaacattaaccgctgatttt
tatgagaaagaactgcggatcattggttcaagtgacggatataattatcaacaacatgca
gattggttttttagtcaaatagaaaaaacaccatggatagaagagatttttcaacatgaa
atacaacatacaggactcattcaatgttttgaggaattaagtcaaggaataattacccct
ttaaaagtatttgtctcatatgaataa

DBGET integrated database retrieval system