KEGG   Bacillus cereus Q1: BCQ_2464Help
Entry
BCQ_2464          CDS       T00852                                 

Gene name
adhB
Definition
zinc-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcq  Bacillus cereus Q1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCQ_2464 (adhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCQ_2464 (adhB)
  Lipid metabolism
   00071 Fatty acid degradation
    BCQ_2464 (adhB)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCQ_2464 (adhB)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCQ_2464 (adhB)
   00626 Naphthalene degradation
    BCQ_2464 (adhB)
Enzymes [BR:bcq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCQ_2464 (adhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2425768..2426694
Genome map
AA seq 308 aa AA seqDB search
MEQNKLVLEGPKRLKWETREIKSIQNDEIIVKTIAGAISIGAELPQYNGSDVTDTHPIYP
RKTGYESYGEVIQVGNKVKNLNIGDKVVSFYGHETIGVVNGYKVIRVPSYIKPKVALLSI
LSCDAAKGILKLNPRQDEKVLIAGMGVIGLLTCYFLKYYIGVEHVDIVEPDRNRREFAQK
FSVKNTFDAEEQIVETYNYGFECSATNSGFHTLQKTLKTNGQICILSDGNIEELTLTADF
YEKELRIIGSSDGYNYQQHADWFFSQIEKTPWIEEIFQHEIQHTGLIQCFEELSQGIITP
LKVFVSYE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaataaattagttttagaaggaccaaaacgtcttaagtgggaaacgcgcgaa
attaagtctatacagaatgatgaaattatcgttaaaacaattgcaggtgcaataagcatt
ggagcagagttacctcagtataatggatccgatgttacagatacacaccctatttatcca
agaaaaactggatatgaaagttacggtgaagtgattcaagttggtaataaagtaaagaat
ttaaacataggcgataaagtagtttctttttatggacatgaaacgataggagtagttaat
gggtataaagtaattcgagtacctagttatataaaacctaaagtagctttattatctatt
ctttcgtgtgatgctgctaaaggtatattgaaactaaacccgcgacaggatgaaaaggta
cttatagctggaatgggagttatcggtttacttacttgttatttcttaaaatactatata
ggtgttgagcatgtggatattgttgaacctgatagaaatagaagggaatttgcacagaaa
tttagtgtaaaaaacacatttgatgcagaagaacagatagtagaaacatataattatggt
ttcgaatgttctgctacaaatagtggattccatacattacaaaaaacacttaaaactaat
ggacaaatatgtatactttctgatggtaatattgaagaactaacattaaccgctgatttt
tatgagaaagaactgcggatcattggttcaagtgacggatataattatcaacaacatgca
gattggttttttagtcaaatagaaaaaacaccatggatagaagagatttttcaacatgaa
atacaacatacaggactcattcaatgttttgaggaattaagtcaaggaataattacccct
ttaaaagtatttgtctcatatgaataa

DBGET integrated database retrieval system