KEGG   Bacillus cereus Q1: BCQ_2615Help
Entry
BCQ_2615          CDS       T00852                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00010  Glycolysis / Gluconeogenesis
bcq00020  Citrate cycle (TCA cycle)
bcq00620  Pyruvate metabolism
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01120  Microbial metabolism in diverse environments
bcq01130  Biosynthesis of antibiotics
bcq01200  Carbon metabolism
Module
bcq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCQ_2615 (acoC)
   00020 Citrate cycle (TCA cycle)
    BCQ_2615 (acoC)
   00620 Pyruvate metabolism
    BCQ_2615 (acoC)
Enzymes [BR:bcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCQ_2615 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N HlyD_D23 GCV_H PYNP_C
Motif
Other DBs
NCBI-ProteinID: ACM13043
UniProt: B9J304
Position
complement(2566870..2568069)
Genome map
AA seq 399 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITSWNIKAGDHVSKGELIASINSEKIETEIEAPADGTVLDIA
VSEDEGVPPGTVICYIGKLNEKVEINESINVVEEKAPNLEPKKVQHPEPYAKEVAKQRIK
ISPVAKKIAKSENLDIKALVGTGPGGRITKVDVLKAIEERVTIPEVLEQEESKVIPVTGM
RKAIANRMHASLQNSAQLTLTMKVDVTDLVALHKEIAAVVQKRYDNKLTITDFVSRAVVL
ALGEHKEMNSAYMDDTIHQFEHVHLGMAVALEKGLVVPAIRFANNLSLVELSKQIKNVAQ
KAREGSLSSDDMQGTTFTISNLGSFGIEYFTPVLNTPETGILGVGAIEHVPVYKGKKIKK
GSMLPLSLTFDHRVLDGAPAAAFLRTIKRYLEEPVTILL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccgaagttaggtatggcgatgaaagaaggtattattacg
agctggaatattaaagcaggcgatcatgtctcaaaaggtgaactaattgctagtattaat
tcggaaaaaatcgaaacggaaatagaagcaccagctgatggaactgttcttgatatagct
gttagtgaagatgagggagttccacctggcactgtcatttgctatatcggtaagctgaac
gaaaaagtagaaatcaatgaaagtataaatgttgtagaagaaaaagcacctaatctagag
cctaaaaaggtccaacatccagaaccatatgcgaaagaagtggcgaagcaaagaatcaaa
atttcacctgtagcgaagaaaattgcaaagtctgaaaatctagatatcaaagcattagtt
ggtacaggccctggcggaaggattacaaaagtagacgtattaaaagcgattgaagaaaga
gtaacaattccagaagtacttgaacaagaagaaagtaaagtaattcctgttactggtatg
cggaaagcaatcgcaaaccgtatgcatgcaagtttacaaaatagtgcgcaattaacatta
acgatgaaagtagatgtgacagatttagttgctttacataaagaaatagcggcagttgta
caaaaacgatacgataacaaactaactattacggatttcgtttctcgtgctgttgtatta
gcacttggagagcataaagaaatgaacagcgcttatatggatgatacaattcatcaattt
gaacatgttcatttaggcatggcagtcgcattagaaaaaggattagtcgttccagctatt
cgctttgctaataatctatctttagtagagttatctaaacaaattaaaaacgttgcacaa
aaagcaagagaaggtagtttaagtagtgatgatatgcaagggacaacctttacaattagt
aatttaggtagcttcggtattgaatattttacgccagtattaaatacacctgaaactggt
attttaggtgtaggtgcaattgaacatgttccagtatataaagggaagaaaataaaaaaa
ggcagtatgttacctttaagtttaacattcgatcatcgtgtattagatggtgcaccagca
gctgcatttttacgcacaattaaacgttatttagaagaacctgtaacaattcttttataa

DBGET integrated database retrieval system