KEGG   Bacillus cereus Q1: BCQ_3034Help
Entry
BCQ_3034          CDS       T00852                                 

Gene name
cypD
Definition
bifunctional p-450:nadph-p450 reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bcq  Bacillus cereus Q1
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bcq00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bcq00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bcq00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2985114..2988311)
Genome map
AA seq 1065 aa AA seqDB search
MDKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKLAEEYGPIFQIQTLSDTIIVVSGHEL
VVEVCDETRFDKSIEGALAKVRAFAGDGLFTSETDEPNWKKAHNILMPTFSQRAMKDYHA
MMVDIAVQLVQKWARLNPNENVDVPGDMTRLTLDTIGLCGFNYRFNSFYRETSHPFITSM
TRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSGNQEENDLLSR
MLHVQDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDR
VLTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV
LIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG
MLLQHFEFIDYEDYQLDVKQTLTLKPGDFKIRIVPRNQTISHTTVLAPTEEKLKNHETKQ
QVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVAALNDRIGSLPKE
GAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTYQRIPRYID
EQMAQKGATRFSKRGEADASGDFEEQLEQWKQSMWSDAMKSFGLELNKNMEKERSTLSLQ
FVSRLGGSPLARTYEAVYASILENRELQSSSSERSTRHIEISLPEGATYKEGDHLGVLPI
NSEKNVNRILKRFGLNGKDQVILSASGRSVNHIPLDSPVRLYDLLSYSVEVQEAATRAQI
REMVTFTVCPPHKKELESLLEEGVYQEQILKKRISMLDLLEKYEACEIRFERFLELLPAL
KPRYYSISSSPLVAQDRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTP
QSNFQLPENPETPIIMVGPGTGIAPFRGFLQARRVQKQKGMKVGEAHLYFGCRHPEKDYL
YRTELENDEREGLISLHTAFSRLEGHPKTYVQHVIKEDRIHLISLLDNGAHLYICGDGSK
MAPDVEDTLCQAYQEIHEVSEQEARNWLDRLQDEGRYGKDVWAGI
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaagtatctgccattcctcagccgaaaacatatggaccgctggggaatctc
ccattaatcgataaagataaaccgactctatcgtttattaagctggcagaagagtatggt
cctatttttcaaattcaaactttaagtgatacgatcattgtcgtttctggacatgaactg
gtagtggaagtttgtgatgaaacaagatttgataaaagtatagagggtgctttagcaaag
gttcgtgcttttgctggagacggactatttacaagcgagactgacgagcctaactggaaa
aaagctcataatattttgatgcctacattcagtcaacgggcaatgaaagattatcatgct
atgatggtcgatattgccgtgcaactcgttcaaaaatgggcaagactgaatccgaatgaa
aatgtagatgtcccaggggatatgactcgccttacattagatacaattggtctatgtggt
tttaattaccgatttaatagcttttatcgtgagacctctcatccttttatcactagcatg
acccgtgctctagatgaggcgatgcaccaattgcagcggctggatatagaagataaactc
atgtggagaacgaaacgtcaatttcagcatgatattcaatctatgttttctttagtagat
aatattattgctgaacgtaaaagtagtgggaatcaggaagaaaatgatttactttcccgt
atgttacatgtgcaggatccggaaacgggtgaaaaattagatgatgaaaatattcgtttt
caaattatcacttttttaatagctgggcatgaaacaacaagtggattgttatcttttgca
atctattttttattaaagaatccggataaattgaaaaaagcctatgaagaagtagaccgt
gttttaacagatcccactccaacataccaacaagttatgaagcttaagtatatacggatg
attttaaatgaatcactacgtctatggccgactgctccagcattcagtctctatgcaaaa
gaagatacagtaattggtggaaaatacccaattaagaaaggcgaagatcgtatctctgtt
cttattccacagctacatagggataaagacgcgtggggagacaatgtggaagaattccaa
cctgaacgatttgaagagctggataaggttcctcatcatgcttataaaccatttggaaat
ggtcagagggcatgtatcggtatgcagtttgcacttcatgaagccacactcgtaatggga
atgcttcttcaacattttgaattcatcgattatgaagactatcagctggacgtaaaacaa
acattaacgctaaaacctggtgattttaaaattaggattgtacctcgaaatcaaactatt
agccatactactgttctggcgcctacagaggagaaactgaaaaaccatgaaaccaagcag
caagttcagaagactccttccattattggagccgataatctttcacttcttgttctgtat
ggctcggatacaggggtagcagaaggtattgcaagagaactagcggatacagctagttta
gaaggtgttcaaacggaagtggcagctcttaacgatcgaattggaagtttgccgaaagaa
ggagcggttcttattgtaacttcttcttataatggaaaaccgccaagtaatgcaggacag
tttgtgcaatggttggaagaattaaaaccagatgagctaaaaggtgttcaatacgcagtt
tttggttgtggagatcataattgggctagtacttatcagcgaattccaagatacattgat
gagcaaatggctcaaaaaggagcaacaaggttttctaaacgcggagaagcagatgcaagt
ggtgattttgaggaacagctcgagcaatggaaacaaagtatgtggtctgatgcgatgaag
tcatttggattggaacttaacaaaaacatggagaaagaacgcagtactttgagcctgcaa
tttgtcagccgtcttggaggatctcctcttgcgcgaacatatgaagcagtttatgcatct
atattagaaaatcgtgaacttcaatcatctagcagtgaaagaagtacgcgacatattgag
atatcattgccagaaggcgctacatataaagaaggagaccaccttggggtactaccaatt
aatagtgagaaaaatgtcaaccgaattttaaaacgctttggattaaacgggaaggatcaa
gtcattttaagtgcaagtgggcgcagtgtaaatcacatacctttagacagtcctgttcgt
ttatatgaccttcttagttatagtgtcgaagtgcaagaagcagctactcgtgcacaaata
cgagaaatggtgacattcacagtatgccctcctcataaaaaggaattggaatcattattg
gaagagggagtttatcaagaacaaatattaaagaaacgtatttcaatgttagatcttctt
gaaaagtatgaggcttgtgaaatccgatttgaacgctttttagaacttcttccggcgctc
aaaccgcgttactattctatctcaagttctccacttgttgcccaggatcgtctgagcatt
acggttggtgttgtaaatgcgcctgcatggagtggggaaggaacatatgaaggagtcgct
tctaattatttagctcagcgtcataataaagatgagattatctgtttcattcgaacgcca
caatcaaactttcaattacctgaaaatccagaaacaccaattatcatggttggaccaggc
actggaattgcaccattccgtggattcttacaagcgcgtcgtgttcaaaagcaaaaaggt
atgaaggtaggagaagcacatctatactttggttgtcgtcatcctgaaaaggattatctc
tatcgtacagaattagaaaatgatgaaagagagggattaatctctttacacacagctttt
tctcgcttagaaggacatcctaaaacatatgtacagcatgtaataaaagaagatagaatc
catttaatttcgttattagataatggggcccatctttatatatgtggtgatggaagtaaa
atggctcctgacgtagaagataccctttgtcaagcctatcaagaaattcatgaagttagt
gaacaagaagcaaggaattggttagatcgtttgcaagatgaagggcgatatggaaaagat
gtttgggctggtatatga

DBGET integrated database retrieval system