KEGG   Bacillus cereus Q1: BCQ_3656Help
Entry
BCQ_3656          CDS       T00852                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bcq  Bacillus cereus Q1
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bcq00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3620022..3620639)
Genome map
AA seq 205 aa AA seqDB search
MRSRRGLLIVLSGPSGVGKGTVRKELFSHEDTRFQYSISVTTRKPREGEVDGVDYFFKER
EEFEEMIRNEKLLEWAEFVGNYYGTPIDYVEKTLQEGKDVFLEIEVQGAIQVKKAFPEGV
FIFLAPPSLSELKNRIVGRGTETEDVIENRLTVAKEEIDMMDAYDYVVENDQVELACERI
KAIVVGEHCRRERVAKYYKEMTEGL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtagaagaggattgctcatcgttctttcaggaccttctggggttggtaaagga
acggttcgaaaagagctgtttagtcatgaggatacacgttttcagtactccatttcagta
acgacacgtaagccacgtgaaggtgaagtggatggtgtggattatttctttaaagagaga
gaagaatttgaggaaatgattcgtaatgaaaaattacttgagtgggctgagttcgtaggt
aattattacggaacaccaattgactatgttgaaaaaacattacaagaaggaaaagatgta
ttcttagaaattgaagtgcaaggagcaattcaagttaagaaagctttcccagaaggtgta
tttattttcttagcacctccaagtttatctgaactaaagaaccgaattgtcggtcgtggt
acagaaactgaagatgttattgaaaatcgtttaacggtagcgaaagaagaaattgatatg
atggacgcttacgactacgttgtagaaaacgaccaagttgaactagcttgtgaaagaatt
aaagcaattgtggttggcgaacattgccgccgcgaaagagtagcaaaatattataaagaa
atgacggagggtctataa

DBGET integrated database retrieval system