KEGG   Bacillus cereus Q1: BCQ_4178Help
Entry
BCQ_4178          CDS       T00852                                 

Gene name
recD
Definition
exodeoxyribonuclease v, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bcq  Bacillus cereus Q1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCQ_4178 (recD)
Enzymes [BR:bcq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BCQ_4178 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4084245..4086581)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYLVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVS
LQLGHVYMRKDQLVRETMSLLNNQEGRVTEEDIVGCIETMQSEGKVIIEEERVYLATLFY
SEKGVVKSIRRLMNQEETPSFPEAEVLKTLGEIEEQLNVQYAPFQQEAIQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKNGTLPPDLAQNQK
DRSFIGCTGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQEVFNPK
REKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKF
LIICGEEAAFQSGVNRLDDAMRQTTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagagaaaaagtttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgaaacgaatgaaacgtacgacgaaaaaaaagtgatgataaacggtcattttccccgc
atgcatgaagatgaagtgtttacgttgacaggtcattttaaagaccatccaaagtatggg
aaacaatatttagttgaaacgtttaagaaagaattgccgcaaacgaaagccggtatggtg
caatatttagcgagtgatttatttaaagggataggaaagcgtacagctgaaaaaattgtg
gaccatctgggggaacatgctatttctaaaattatggatgatcctgaggctttaaatggt
gttgtcaacaagcaaaaagcacaagaaatttatgagacaattgttgaacatcaagggcta
gagaaagtaatgagctttttaaatggctacggttttggaacgaagctttctattaagatt
tatcagcaatataaagagatgacattagaagtaattcgtaataacccgtaccaacttatt
gaagaagtggacggaattggttttggaagagcggatgatatcgggcgtgcgttagggata
tcgggtaatcacgacgaccgtgtacgcgcaggatgtttttacacgttagagaatgtctca
ttacaacttggtcacgtttatatgaggaaagaccaacttgtaagagaaacgatgtcactt
ttaaacaatcaagaaggaagagtgactgaggaagatattgtaggttgtattgaaacgatg
caaagtgaagggaaagtcatcatagaagaagagcgagtgtatttagcaacgttattctac
tctgaaaaaggtgttgtaaagtccattcgcaggcttatgaatcaagaagaaacaccttca
tttccagaggcagaagtgttaaaaacattaggtgaaattgaagaacaactgaacgtacaa
tatgcaccgtttcagcaagaagcaattcaaacggcacttcataaaccgatgatgttattg
acaggtggaccaggaacaggaaaaacaacagttattaaaggaattgttgaaatgtatgcg
tcacttcacgggctatcgttaaatccgaatgaatacagtgatgataatccatttccgata
ttattaacggctccaacaggaagggcagcgaagcgaatgagtgaatcaacagggcttcca
gcttgtacaattcaccgtttacttggctggacgccagaagggtctttccagcggaatgaa
acagatccggtacaagggaaattactcattattgatgaattttcaatggttgatatttgg
cttgcaaatcagctgtttaagtcattgccgactaacattcaagttatcgttgtaggcgat
gaagatcaattaccatctgtaggacctggacaagtattaaaagatttattgaatgcaggt
gcagttccaacagtaaagcttactgagatttatcgtcaagcggaaggttcatcagtaatt
caacttgcccatgcgataaaaaatggaacgctcccaccagatttagcgcaaaaccaaaaa
gatcgttcatttatcggttgtacaggagctcaaattgttgaggttgttaagaaggtttgt
gagaatgcgaagacaaaagggtttagcgcaagagatgtacaagtattagccccgatgtat
cgtggaccggcgggtattaatgtactaaacgaagcgttgcaagaagtgtttaatccgaaa
agggaaaagagtaaagaaattgcttacggtgatgttgtataccgaagaggcgataaagtc
ttgcaacttgttaatcagccggagagccaagtgtttaatggtgatatcggcgaaattgtt
tcggtgttttatgcgaaagagaacgttgagcaacaagatatgattatcgtttcatttgat
ggaattgaggtaacatatacaaaaccagatttaaatcaaattacacatgcctattgctgt
tcgattcataaatcacaaggtagtgaatttccgattgtgattatgccgatagtaaaaagt
tataatcgtatgttacgtcgtaatttaatttatactggtattacaagaagtaagaagttc
cttattatttgcggggaggaagctgctttccagtctggtgtaaatcgccttgatgatgca
atgcgtcaaacgactttagctagtcgattgcaagaatcacaaggagaagtacagatggta
acggttaacggcgaagaaatggacgtggaaaacatttcaccgtatgattttatgtaa

DBGET integrated database retrieval system