KEGG   Bacillus cereus Q1: BCQ_4219Help
Entry
BCQ_4219          CDS       T00852                                 

Definition
cysteine desulfurase
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
bcq  Bacillus cereus Q1
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BCQ_4219
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    BCQ_4219
Enzymes [BR:bcq01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     BCQ_4219
Transfer RNA biogenesis [BR:bcq03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    BCQ_4219
 Prokaryotic Type
    BCQ_4219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4126934..4128073
Genome map
AA seq 379 aa AA seqDB search
MIYLDYAATTPMSAEALQTYTKAASQYFGNEQSLHDIGGTASSLLQVCRKTFAEMIGGKE
QGIFFTSGGSESNYLAIQSLLNAQNKKHIITTPMEHASIRSYFQSLQSKGYTITEIPVDK
NGLIRLIDLEEAITEDTVLASIQHGNSEIGTVQNIAEIGALLKKYNVLFHSDCVQTFGKL
PIHVFEMGIDSLSVSAHKIYGPKGVGACYINPQVRWTQIFPGTSHEKGFRPGTVNVPGIA
AFLTAAENILKNQQEESLRFKGLRSYFLEQIRTLPLKIEVEGHSTSCLPHIIGVTIKGIE
GQYTMLECNRHGIAISTGSACQVGKQEPSKTMLAIGKTYEEAKQYVRFSFGQQTTKDQID
TTIHALHTIGNQFYRGVKS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgatatatcttgattatgcagctactacacctatgagcgcggaagcattacaaacatat
acgaaagcagcatcgcaatacttcggaaatgaacaaagtttacacgatattggaggaacg
gcctcttctttactacaagtttgtagaaaaacatttgccgaaatgattggcggaaaggaa
caagggatattcttcacgagcggtggatcagaatcgaactaccttgcgattcagtccctt
ctcaatgcccaaaataagaagcatattattacgacacctatggaacatgcatccattcga
agttattttcaatccttacaatcaaaagggtatacaattactgaaattcctgttgataaa
aatggactcattcgtttaatagatttagaagaagctattacagaagatactgttctagca
agtatacagcacggaaactctgaaatcggaaccgttcaaaatatcgcagagattggggca
cttttaaaaaaatataacgttttatttcattcagattgtgtacaaacctttggtaaactt
cctatccatgtttttgagatggggattgatagtctttctgtttcagcacataagatatac
ggaccgaagggtgttggcgcttgctatatcaatccgcaagttcgctggacacaaatattt
ccggggacttctcacgaaaaaggatttcgtccaggtacagtgaacgttcctggcatcgca
gcttttttaacagctgctgagaatatattaaaaaatcaacaagaagaaagtttacgtttt
aaagggttacgatcttactttttagagcaaatacgaacacttccactaaaaattgaagta
gaaggtcattctacttcttgtttaccacatattattggggttacaataaaaggaatagaa
ggccaatatacaatgctagaatgtaatcgccatggtattgccatttctaccggaagtgct
tgccaagttggtaaacaagaaccttcgaaaacaatgcttgcaattggaaaaacgtatgaa
gaggcaaaacaatatgtccgcttctctttcggacaacaaacaacgaaagatcaaattgat
actactattcatgcactacacacaattggaaatcaattttatagaggtgttaaatcataa

DBGET integrated database retrieval system