KEGG   Bacillus cereus Q1: BCQ_4250Help
Entry
BCQ_4250          CDS       T00852                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00860  Porphyrin and chlorophyll metabolism
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCQ_4250 (hemD)
Enzymes [BR:bcq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BCQ_4250 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 AAA_8 Glyco_tranf_2_3
Motif
Other DBs
NCBI-ProteinID: ACM14677
UniProt: B9IZ38
Position
complement(4158939..4159691)
Genome map
AA seq 250 aa AA seqDB search
MNALAGKTVLVTRAQHQAKQMSVAVKEKSGIPLEIPLLRMEGMSHRQIQHIAGQLHSYDW
VIFTSKNGVAFFLDRLRQKLPVTTKIAAVGVKTKLELEKRGYRVDFVPTSFVAEVFAEEF
VKRLSGNERILFPKGNLARDVIPVALREMGVSLDELIVYGTKENVEKRQELIEALEVGKV
DIITFTSPSTVTSFVRLLEDTNWREWTKKCTIACIGPITEKEASLYFSHIIMPKEYTVEA
LLQCVCESIK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctcgctggcaaaacggtattggttacgcgtgcccagcatcaagcaaaacaa
atgagtgtagcggtgaaagaaaagagcggaattccattggaaattccgcttttgcgtatg
gaaggtatgtctcataggcaaattcaacatatagcagggcagttacattcgtatgactgg
gttatttttacgagtaaaaatggggtagctttttttctagatcgtttgagacagaagcta
cctgtaacgactaaaattgctgcagtaggtgtgaaaacaaagttagagttagaaaagcga
ggctatcgagtggattttgttccaacttcatttgttgcagaagtatttgcagaagagttt
gtaaaaagattaagtggaaacgaacgtattttatttccgaaagggaatttagcaagagac
gtaattccagttgcgcttcgtgaaatgggtgtttctctagatgagcttatcgtatatggt
acgaaagaaaatgtagagaaaaggcaagagcttatagaagcgttagaagtagggaaagta
gacattattacatttacgagcccttccactgttacgagttttgttcgtttacttgaggat
acaaactggagagaatggacaaaaaaatgtacaattgcttgtatagggcctattacggaa
aaagaggcgagcctttatttttcgcatattattatgccgaaagagtacactgtagaagca
ttactacaatgtgtttgtgaatctataaaataa

DBGET integrated database retrieval system